BLASTX nr result
ID: Papaver22_contig00034398
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00034398 (875 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521029.1| conserved hypothetical protein [Ricinus comm... 72 2e-10 emb|CAN78770.1| hypothetical protein VITISV_024249 [Vitis vinifera] 69 2e-09 >ref|XP_002521029.1| conserved hypothetical protein [Ricinus communis] gi|223539866|gb|EEF41446.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/61 (55%), Positives = 46/61 (75%) Frame = +1 Query: 187 RPATRSRPVSSRRLIRMKVRRLQKLVPGGKGLQPDRLFLETANYILHLKFQVNVLQTLSN 366 R R ++ I+M+V++LQ+L+PGG+ LQPDRLFL TA+YILHL+ QVNVLQ LS Sbjct: 25 RRRRRGAATATTTSIQMRVKKLQRLIPGGEELQPDRLFLRTADYILHLELQVNVLQALSE 84 Query: 367 M 369 + Sbjct: 85 I 85 >emb|CAN78770.1| hypothetical protein VITISV_024249 [Vitis vinifera] Length = 77 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = +1 Query: 220 RRLIRMKVRRLQKLVPGGKGLQPDRLFLETANYILHLKFQVNVL 351 RR +R KV++LQ+L+PGG+GLQPDRLFL TA+YILHL+ Q+ +L Sbjct: 19 RRSVRRKVKKLQRLIPGGRGLQPDRLFLRTADYILHLRLQMGIL 62