BLASTX nr result
ID: Papaver22_contig00033123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00033123 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB08928.1| unnamed protein product [Arabidopsis thaliana] 56 3e-06 ref|XP_002872114.1| hypothetical protein ARALYDRAFT_326738 [Arab... 56 3e-06 ref|NP_197833.2| Transcription factor IIIC, subunit 5 [Arabidops... 56 3e-06 gb|AAL38268.1| unknown protein [Arabidopsis thaliana] gi|2213612... 56 3e-06 ref|XP_002529107.1| conserved hypothetical protein [Ricinus comm... 54 1e-05 >dbj|BAB08928.1| unnamed protein product [Arabidopsis thaliana] Length = 552 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +2 Query: 227 EDLCPFRVFPWKCQTAVQLFKLDDGYFKQEIKKASRTNTRQY 352 +D+C F+VFP+KCQT +QLF+LDD Y +QEI+K + T Y Sbjct: 336 DDICAFKVFPFKCQTFLQLFELDDEYIQQEIRKPPKQTTCNY 377 >ref|XP_002872114.1| hypothetical protein ARALYDRAFT_326738 [Arabidopsis lyrata subsp. lyrata] gi|297317951|gb|EFH48373.1| hypothetical protein ARALYDRAFT_326738 [Arabidopsis lyrata subsp. lyrata] Length = 555 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +2 Query: 227 EDLCPFRVFPWKCQTAVQLFKLDDGYFKQEIKKASRTNTRQY 352 +D+C F+VFP+KCQT +QLF+LDD Y +QEI+K + T Y Sbjct: 342 DDICAFKVFPFKCQTFLQLFELDDEYIQQEIRKPPKQTTCNY 383 >ref|NP_197833.2| Transcription factor IIIC, subunit 5 [Arabidopsis thaliana] gi|332005929|gb|AED93312.1| Transcription factor IIIC, subunit 5 [Arabidopsis thaliana] Length = 554 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +2 Query: 227 EDLCPFRVFPWKCQTAVQLFKLDDGYFKQEIKKASRTNTRQY 352 +D+C F+VFP+KCQT +QLF+LDD Y +QEI+K + T Y Sbjct: 345 DDICAFKVFPFKCQTFLQLFELDDEYIQQEIRKPPKQTTCNY 386 >gb|AAL38268.1| unknown protein [Arabidopsis thaliana] gi|22136120|gb|AAM91138.1| unknown protein [Arabidopsis thaliana] Length = 425 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +2 Query: 227 EDLCPFRVFPWKCQTAVQLFKLDDGYFKQEIKKASRTNTRQY 352 +D+C F+VFP+KCQT +QLF+LDD Y +QEI+K + T Y Sbjct: 216 DDICAFKVFPFKCQTFLQLFELDDEYIQQEIRKPPKQTTCNY 257 >ref|XP_002529107.1| conserved hypothetical protein [Ricinus communis] gi|223531458|gb|EEF33291.1| conserved hypothetical protein [Ricinus communis] Length = 540 Score = 54.3 bits (129), Expect = 1e-05 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = +2 Query: 221 KQEDLCPFRVFPWKCQTAVQLFKLDDGYFKQEIKKASRTNTRQY 352 K EDLC F+VFP+K QT++QL +LDD Y +QEIKK + T Y Sbjct: 321 KWEDLCKFQVFPYKFQTSLQLCELDDDYIQQEIKKPPKQTTCTY 364