BLASTX nr result
ID: Papaver22_contig00033092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00033092 (460 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ49159.1| protection of telomeres 1 protein [Populus tricho... 70 1e-10 gb|ACJ49158.1| protection of telomeres 1 protein [Lactuca sativa] 65 6e-09 emb|CAN69474.1| hypothetical protein VITISV_014375 [Vitis vinifera] 65 7e-09 gb|ADE75798.1| unknown [Picea sitchensis] 64 2e-08 ref|XP_004137504.1| PREDICTED: protection of telomeres protein 1... 63 2e-08 >gb|ACJ49159.1| protection of telomeres 1 protein [Populus trichocarpa] Length = 462 Score = 70.5 bits (171), Expect = 1e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 39 NPPWIQCCLKSYYLDKNDQFGSRTYRIFGTKLVD 140 NPPW+QCCLKSYYLDKND +GSR YRIFGTKL D Sbjct: 429 NPPWVQCCLKSYYLDKNDIWGSRQYRIFGTKLAD 462 >gb|ACJ49158.1| protection of telomeres 1 protein [Lactuca sativa] Length = 466 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 18 ENKRVVINPPWIQCCLKSYYLDKNDQFGSRTYRIFGTKLVDY 143 EN NPPWI CCLKSYY+DKND +GSR Y IF TKL+++ Sbjct: 419 ENNGKARNPPWIDCCLKSYYVDKNDMWGSRRYGIFDTKLINW 460 >emb|CAN69474.1| hypothetical protein VITISV_014375 [Vitis vinifera] Length = 1383 Score = 64.7 bits (156), Expect = 7e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 39 NPPWIQCCLKSYYLDKNDQFGSRTYRIFGTKLV 137 NPPW+QCC+KSYYL K D +GSRTYRIFGT+LV Sbjct: 1350 NPPWVQCCIKSYYLVKGDVWGSRTYRIFGTRLV 1382 >gb|ADE75798.1| unknown [Picea sitchensis] Length = 484 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 12 DGENKRVVINPPWIQCCLKSYYLDKNDQFGSRTYRIFGTKL 134 +GE +R+ NPPWI+CC+KSYYLDKN + SR YRIFGT L Sbjct: 443 EGEKRRIC-NPPWIECCIKSYYLDKNSPWESRRYRIFGTTL 482 >ref|XP_004137504.1| PREDICTED: protection of telomeres protein 1a-like [Cucumis sativus] gi|449503109|ref|XP_004161838.1| PREDICTED: protection of telomeres protein 1a-like [Cucumis sativus] Length = 449 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 18 ENKRVVINPPWIQCCLKSYYLDKNDQFGSRTYRIFGTKLV 137 +N+ +PPW+QCCLKSYYL+K D GSR YRIFGT+LV Sbjct: 407 KNEASTRDPPWVQCCLKSYYLNKQDVLGSRQYRIFGTRLV 446