BLASTX nr result
ID: Papaver22_contig00033008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00033008 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278289.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 65 4e-09 ref|XP_003521174.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 62 4e-08 ref|XP_002529606.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|NP_567993.1| cytoplasmic tRNA 2-thiolation protein 2 [Arabid... 59 5e-07 dbj|BAD43700.1| unnamed protein product [Arabidopsis thaliana] g... 59 5e-07 >ref|XP_002278289.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 2 [Vitis vinifera] gi|297739656|emb|CBI29838.3| unnamed protein product [Vitis vinifera] Length = 468 Score = 65.5 bits (158), Expect = 4e-09 Identities = 37/65 (56%), Positives = 41/65 (63%) Frame = +2 Query: 2 IFGXXXXXXXQFQILPKEHSSMEQFYSFLPQPMIARAPKESMNGDQAWLREQIKDCLLSD 181 IFG QFQILPKE SME FYS LPQ + +A S + Q LREQI+D LLSD Sbjct: 405 IFGATCCPSCQFQILPKEPVSMEHFYSLLPQQFVVQAKDRSFS-MQRQLREQIQDFLLSD 463 Query: 182 GEDGT 196 EDGT Sbjct: 464 SEDGT 468 >ref|XP_003521174.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 2-like [Glycine max] Length = 458 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = +2 Query: 32 QFQILPKEHSSMEQFYSFLPQPMIARAPKESMNGDQAWLREQIKDCLLSDGEDGT 196 +FQILP + +MEQFY LPQ ++ RA K++ NG+ + LREQI+D LLSDGED T Sbjct: 405 RFQILPSDSMAMEQFYMDLPQSVVGRA-KQANNGNLSLLREQIQDYLLSDGEDET 458 >ref|XP_002529606.1| conserved hypothetical protein [Ricinus communis] gi|223530891|gb|EEF32751.1| conserved hypothetical protein [Ricinus communis] Length = 167 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +2 Query: 35 FQILPKEHSSMEQFYSFLPQPMIARAPKESMNGDQAWLREQIKDCLLSDGED 190 FQILPK+ S ME FY LPQ ++ RA K + + + LREQI+DCLLSDGED Sbjct: 117 FQILPKDPSLMEHFYLSLPQHLVTRA-KRGSSDNLSLLREQIQDCLLSDGED 167 >ref|NP_567993.1| cytoplasmic tRNA 2-thiolation protein 2 [Arabidopsis thaliana] gi|332278212|sp|O65628.3|CTU2_ARATH RecName: Full=Cytoplasmic tRNA 2-thiolation protein 2 gi|115646788|gb|ABJ17118.1| At4g35910 [Arabidopsis thaliana] gi|332661188|gb|AEE86588.1| cytoplasmic tRNA 2-thiolation protein 2 [Arabidopsis thaliana] Length = 458 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/53 (54%), Positives = 41/53 (77%) Frame = +2 Query: 32 QFQILPKEHSSMEQFYSFLPQPMIARAPKESMNGDQAWLREQIKDCLLSDGED 190 +FQILP++ SS+EQF SFLP MI++ + ++ QA+LRE+IKDCLL D E+ Sbjct: 405 RFQILPQDGSSLEQFSSFLPDHMISQVKHQKVD-SQAYLREKIKDCLLLDDEE 456 >dbj|BAD43700.1| unnamed protein product [Arabidopsis thaliana] gi|62318837|dbj|BAD93893.1| hypothetical protein [Arabidopsis thaliana] Length = 458 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/53 (54%), Positives = 41/53 (77%) Frame = +2 Query: 32 QFQILPKEHSSMEQFYSFLPQPMIARAPKESMNGDQAWLREQIKDCLLSDGED 190 +FQILP++ SS+EQF SFLP MI++ + ++ QA+LRE+IKDCLL D E+ Sbjct: 405 RFQILPQDGSSLEQFSSFLPDHMISQVKHQKVD-SQAYLREKIKDCLLLDDEE 456