BLASTX nr result
ID: Papaver22_contig00032996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00032996 (529 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB60738.1| Strong similarity to Dianthus cysteine proteinase... 59 3e-07 ref|XP_002307688.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002510459.1| cysteine protease, putative [Ricinus communi... 57 2e-06 ref|NP_563855.1| xylem bark cysteine peptidase 3 [Arabidopsis th... 55 5e-06 gb|AAK71314.1|AF388175_1 papain-like cysteine peptidase XBCP3 [A... 55 5e-06 >gb|AAB60738.1| Strong similarity to Dianthus cysteine proteinase (gb|U17135) [Arabidopsis thaliana] Length = 416 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/76 (38%), Positives = 38/76 (50%), Gaps = 4/76 (5%) Frame = +3 Query: 249 HQPLAPASPLKPTKCSL*PSMRQGNPDVAVRVYYGI----KYCTLDAIMCCEDCEHCFLQ 416 H P SP PTKC+L G R +G+ K C +++ +CC+D HC Sbjct: 341 HPNPPPPSPPGPTKCNLFTYCSSGETCCCARELFGLCFSWKCCEIESAVCCKDGRHCCPH 400 Query: 417 DYPICYTETSQCFKVF 464 DYP+C T S C KVF Sbjct: 401 DYPVCDTTRSLCLKVF 416 >ref|XP_002307688.1| predicted protein [Populus trichocarpa] gi|222857137|gb|EEE94684.1| predicted protein [Populus trichocarpa] Length = 436 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/69 (40%), Positives = 37/69 (53%), Gaps = 4/69 (5%) Frame = +3 Query: 264 PASPLKPTKCSL*PSMRQGNPDVAVRVYYGI----KYCTLDAIMCCEDCEHCFLQDYPIC 431 P P PTKC+L G R ++GI K C LD+ +CC+D HC DYP+C Sbjct: 337 PPPPPGPTKCNLLTYCAAGETCCCARKFFGICISWKCCGLDSAVCCKDRLHCCPHDYPVC 396 Query: 432 YTETSQCFK 458 T+ + CFK Sbjct: 397 DTDKNMCFK 405 >ref|XP_002510459.1| cysteine protease, putative [Ricinus communis] gi|223551160|gb|EEF52646.1| cysteine protease, putative [Ricinus communis] Length = 422 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/70 (38%), Positives = 37/70 (52%), Gaps = 4/70 (5%) Frame = +3 Query: 264 PASPLKPTKCSL*PSMRQGNPDVAVRVYYGI----KYCTLDAIMCCEDCEHCFLQDYPIC 431 P +P PTKC L +G R +G+ K C LD+ +CC+D HC DYP+C Sbjct: 342 PPAPPGPTKCDLFTRCGEGETCCCTRRIFGLCFSWKCCELDSAVCCKDGLHCCPHDYPVC 401 Query: 432 YTETSQCFKV 461 T+ + C KV Sbjct: 402 DTKRNMCLKV 411 >ref|NP_563855.1| xylem bark cysteine peptidase 3 [Arabidopsis thaliana] gi|110741821|dbj|BAE98853.1| papain-like cysteine peptidase XBCP3 [Arabidopsis thaliana] gi|111074448|gb|ABH04597.1| At1g09850 [Arabidopsis thaliana] gi|332190386|gb|AEE28507.1| xylem bark cysteine peptidase 3 [Arabidopsis thaliana] Length = 437 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/74 (36%), Positives = 36/74 (48%), Gaps = 4/74 (5%) Frame = +3 Query: 249 HQPLAPASPLKPTKCSL*PSMRQGNPDVAVRVYYGI----KYCTLDAIMCCEDCEHCFLQ 416 H P SP PTKC+L G R +G+ K C +++ +CC+D HC Sbjct: 336 HPNPPPPSPPGPTKCNLFTYCSSGETCCCARELFGLCFSWKCCEIESAVCCKDGRHCCPH 395 Query: 417 DYPICYTETSQCFK 458 DYP+C T S C K Sbjct: 396 DYPVCDTTRSLCLK 409 >gb|AAK71314.1|AF388175_1 papain-like cysteine peptidase XBCP3 [Arabidopsis thaliana] Length = 437 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/74 (36%), Positives = 36/74 (48%), Gaps = 4/74 (5%) Frame = +3 Query: 249 HQPLAPASPLKPTKCSL*PSMRQGNPDVAVRVYYGI----KYCTLDAIMCCEDCEHCFLQ 416 H P SP PTKC+L G R +G+ K C +++ +CC+D HC Sbjct: 336 HPNPPPPSPPGPTKCNLFTYCSSGETCCCARELFGLCFSWKCCEIESAVCCKDGRHCCPH 395 Query: 417 DYPICYTETSQCFK 458 DYP+C T S C K Sbjct: 396 DYPVCDTTRSLCLK 409