BLASTX nr result
ID: Papaver22_contig00032864
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00032864 (561 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004161775.1| PREDICTED: ribosome biogenesis protein BMS1 ... 59 7e-07 ref|XP_004139860.1| PREDICTED: ribosome biogenesis protein BMS1 ... 59 7e-07 >ref|XP_004161775.1| PREDICTED: ribosome biogenesis protein BMS1 homolog [Cucumis sativus] Length = 553 Score = 58.5 bits (140), Expect = 7e-07 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = -1 Query: 561 PKMEG--PKGVLAKCIFESEILTSDTVFMHVWNKVEVPRDFKPLMVASKPSNRIWK 400 PK +G PK +A+C FE +I SD VF+ W KVEVP+ + PL A +P +R+W+ Sbjct: 353 PKKKGGPPKEGIARCTFEDKIRMSDIVFLRAWTKVEVPKFYNPLTTALQPRDRVWQ 408 >ref|XP_004139860.1| PREDICTED: ribosome biogenesis protein BMS1 homolog [Cucumis sativus] Length = 1198 Score = 58.5 bits (140), Expect = 7e-07 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = -1 Query: 561 PKMEG--PKGVLAKCIFESEILTSDTVFMHVWNKVEVPRDFKPLMVASKPSNRIWK 400 PK +G PK +A+C FE +I SD VF+ W KVEVP+ + PL A +P +R+W+ Sbjct: 998 PKKKGGPPKEGIARCTFEDKIRMSDIVFLRAWTKVEVPKFYNPLTTALQPRDRVWQ 1053