BLASTX nr result
ID: Papaver22_contig00032611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00032611 (521 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002961054.1| hypothetical protein SELMODRAFT_266556 [Sela... 58 9e-07 ref|XP_002966958.1| hypothetical protein SELMODRAFT_439828 [Sela... 58 9e-07 ref|XP_003566399.1| PREDICTED: importin subunit alpha-1a-like [B... 57 2e-06 ref|XP_002302745.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 gb|ABK93106.1| unknown [Populus trichocarpa] 57 2e-06 >ref|XP_002961054.1| hypothetical protein SELMODRAFT_266556 [Selaginella moellendorffii] gi|300171993|gb|EFJ38593.1| hypothetical protein SELMODRAFT_266556 [Selaginella moellendorffii] Length = 527 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 463 IHSIDEEILTSACRTLSYI*NDINEKIQAVIDAGVCPR 350 IHS DEE+LT AC LSYI + N+KIQAVI+AGVCPR Sbjct: 249 IHSTDEEVLTDACWALSYISDGTNDKIQAVIEAGVCPR 286 >ref|XP_002966958.1| hypothetical protein SELMODRAFT_439828 [Selaginella moellendorffii] gi|300164949|gb|EFJ31557.1| hypothetical protein SELMODRAFT_439828 [Selaginella moellendorffii] Length = 527 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 463 IHSIDEEILTSACRTLSYI*NDINEKIQAVIDAGVCPR 350 IHS DEE+LT AC LSYI + N+KIQAVI+AGVCPR Sbjct: 249 IHSTDEEVLTDACWALSYISDGTNDKIQAVIEAGVCPR 286 >ref|XP_003566399.1| PREDICTED: importin subunit alpha-1a-like [Brachypodium distachyon] Length = 522 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -2 Query: 472 ATQIHSIDEEILTSACRTLSYI*NDINEKIQAVIDAGVCPR 350 A IHS DEE+LT AC LSY+ + N+KIQ+VIDAGVCPR Sbjct: 245 ARLIHSNDEEVLTDACWALSYLSDGTNDKIQSVIDAGVCPR 285 >ref|XP_002302745.1| predicted protein [Populus trichocarpa] gi|222844471|gb|EEE82018.1| predicted protein [Populus trichocarpa] Length = 539 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 463 IHSIDEEILTSACRTLSYI*NDINEKIQAVIDAGVCPR 350 IHS DEE+LT AC LSY+ + NEKIQAVI+AGVCPR Sbjct: 259 IHSNDEEVLTDACWALSYLSDGSNEKIQAVIEAGVCPR 296 >gb|ABK93106.1| unknown [Populus trichocarpa] Length = 539 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 463 IHSIDEEILTSACRTLSYI*NDINEKIQAVIDAGVCPR 350 IHS DEE+LT AC LSY+ + NEKIQAVI+AGVCPR Sbjct: 259 IHSNDEEVLTDACWALSYLSDGSNEKIQAVIEAGVCPR 296