BLASTX nr result
ID: Papaver22_contig00032558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00032558 (657 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIE76322.1| hypothetical protein RO3G_01026 [Rhizopus delemar... 56 5e-06 >gb|EIE76322.1| hypothetical protein RO3G_01026 [Rhizopus delemar RA 99-880] Length = 165 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -3 Query: 286 PGRPAYAMTIDKSQGQSVKYVGIGLCTPLFSHGKLCKELS 167 P RP++AMTI+KSQGQS+K VG+ LC P+F+HG+L LS Sbjct: 91 PVRPSFAMTINKSQGQSLKIVGVDLCLPVFTHGQLYVALS 130