BLASTX nr result
ID: Papaver22_contig00032214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00032214 (473 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150471.1| PREDICTED: 30S ribosomal protein S10, chloro... 62 5e-08 sp|Q9M4Y3.1|RR10_MESCR RecName: Full=30S ribosomal protein S10, ... 62 5e-08 gb|AFK36859.1| unknown [Lotus japonicus] 62 5e-08 emb|CBI39707.3| unnamed protein product [Vitis vinifera] 62 5e-08 ref|NP_001236439.1| uncharacterized protein LOC100526953 [Glycin... 62 5e-08 >ref|XP_004150471.1| PREDICTED: 30S ribosomal protein S10, chloroplastic-like [Cucumis sativus] gi|449519589|ref|XP_004166817.1| PREDICTED: 30S ribosomal protein S10, chloroplastic-like [Cucumis sativus] Length = 206 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 472 FEIRTHQRLIDILYPTEQTLESLMRLEFPFAVDVDVKM 359 FEIRTHQRLIDILYPT QT++SLM+L+ P VDV+VK+ Sbjct: 169 FEIRTHQRLIDILYPTAQTIDSLMQLDLPAGVDVEVKL 206 >sp|Q9M4Y3.1|RR10_MESCR RecName: Full=30S ribosomal protein S10, chloroplastic; Flags: Precursor gi|188036211|pdb|3BBN|J Chain J, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome. gi|7578929|gb|AAF64190.1|AF245665_1 plastid ribosomal protein S10 precursor [Mesembryanthemum crystallinum] Length = 197 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 472 FEIRTHQRLIDILYPTEQTLESLMRLEFPFAVDVDVKM 359 FEIRTHQRLIDILYPT QT++SLM+L+ P VDV+VK+ Sbjct: 160 FEIRTHQRLIDILYPTAQTIDSLMQLDLPAGVDVEVKL 197 >gb|AFK36859.1| unknown [Lotus japonicus] Length = 196 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 472 FEIRTHQRLIDILYPTEQTLESLMRLEFPFAVDVDVKM 359 FEIRTHQRLIDILYPT QT++SLM+L+ P VDV+VK+ Sbjct: 159 FEIRTHQRLIDILYPTAQTIDSLMQLDLPAGVDVEVKL 196 >emb|CBI39707.3| unnamed protein product [Vitis vinifera] Length = 200 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 472 FEIRTHQRLIDILYPTEQTLESLMRLEFPFAVDVDVKM 359 FEIRTHQRLIDILYPT QT++SLM+L+ P VDV+VK+ Sbjct: 163 FEIRTHQRLIDILYPTAQTIDSLMQLDLPAGVDVEVKL 200 >ref|NP_001236439.1| uncharacterized protein LOC100526953 [Glycine max] gi|255631238|gb|ACU15986.1| unknown [Glycine max] Length = 205 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 472 FEIRTHQRLIDILYPTEQTLESLMRLEFPFAVDVDVKM 359 FEIRTHQRLIDILYPT QT++SLM+L+ P VDV+VK+ Sbjct: 168 FEIRTHQRLIDILYPTAQTIDSLMQLDLPAGVDVEVKL 205