BLASTX nr result
ID: Papaver22_contig00031901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00031901 (527 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530332.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 >ref|XP_003530332.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18950-like [Glycine max] Length = 577 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/74 (41%), Positives = 42/74 (56%) Frame = -3 Query: 522 MLGNKMKPQEETFSELIKCLTSNGRLEDAVLVLTSMFTSGYTLREPTYKLLKSKFAKSDS 343 ML K KPQ++TF LI L+ RL+D ++VL MF GY L + T L SKF++ + Sbjct: 504 MLSWKQKPQKQTFEYLINSLSQENRLDDILVVLDFMFRIGYILEKGTIYSLVSKFSRDNF 563 Query: 342 FQAVECLERFLGSN 301 CLE+ L N Sbjct: 564 HFPDLCLEKILERN 577