BLASTX nr result
ID: Papaver22_contig00031818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00031818 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFN26939.1| FIL protein [Papaver somniferum] 134 8e-30 gb|AAS10177.1| YABBY-like transcription factor GRAMINIFOLIA [Ant... 121 7e-26 ref|XP_003517025.1| PREDICTED: axial regulator YABBY 1-like [Gly... 120 1e-25 gb|AEK35320.1| YABBY3-like protein [Eschscholzia californica sub... 120 1e-25 ref|XP_002266233.1| PREDICTED: axial regulator YABBY 1 [Vitis vi... 120 1e-25 >gb|AFN26939.1| FIL protein [Papaver somniferum] Length = 230 Score = 134 bits (337), Expect = 8e-30 Identities = 62/62 (100%), Positives = 62/62 (100%) Frame = -3 Query: 209 EQLCYVHCNLCDTVLAVSVPCSSLYKTVTVRCGHCTNLLSVNMRGLLLPAASNQLHLGHA 30 EQLCYVHCNLCDTVLAVSVPCSSLYKTVTVRCGHCTNLLSVNMRGLLLPAASNQLHLGHA Sbjct: 16 EQLCYVHCNLCDTVLAVSVPCSSLYKTVTVRCGHCTNLLSVNMRGLLLPAASNQLHLGHA 75 Query: 29 FF 24 FF Sbjct: 76 FF 77 >gb|AAS10177.1| YABBY-like transcription factor GRAMINIFOLIA [Antirrhinum majus] Length = 211 Score = 121 bits (303), Expect = 7e-26 Identities = 57/62 (91%), Positives = 59/62 (95%) Frame = -3 Query: 209 EQLCYVHCNLCDTVLAVSVPCSSLYKTVTVRCGHCTNLLSVNMRGLLLPAASNQLHLGHA 30 EQLCYVHCN CDTVLAVSVPC+SL KTVTVRCGHCTNLLSVNMRGLLLPAA NQLHLGH+ Sbjct: 18 EQLCYVHCNFCDTVLAVSVPCTSLIKTVTVRCGHCTNLLSVNMRGLLLPAA-NQLHLGHS 76 Query: 29 FF 24 FF Sbjct: 77 FF 78 >ref|XP_003517025.1| PREDICTED: axial regulator YABBY 1-like [Glycine max] Length = 215 Score = 120 bits (301), Expect = 1e-25 Identities = 55/62 (88%), Positives = 60/62 (96%) Frame = -3 Query: 209 EQLCYVHCNLCDTVLAVSVPCSSLYKTVTVRCGHCTNLLSVNMRGLLLPAASNQLHLGHA 30 +QLCYVHCN CDTVLAVSVPC+SL+KTVTVRCGHCTNLLSVNMRGLLLP+A NQLHLGH+ Sbjct: 18 DQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPSA-NQLHLGHS 76 Query: 29 FF 24 FF Sbjct: 77 FF 78 >gb|AEK35320.1| YABBY3-like protein [Eschscholzia californica subsp. californica] Length = 228 Score = 120 bits (301), Expect = 1e-25 Identities = 56/62 (90%), Positives = 59/62 (95%) Frame = -3 Query: 209 EQLCYVHCNLCDTVLAVSVPCSSLYKTVTVRCGHCTNLLSVNMRGLLLPAASNQLHLGHA 30 EQLCYVHCNLCDTVLAVSVPCSSL+KTVTVRCGHCTNLLSVNMRGLLLP A+NQLH GH+ Sbjct: 20 EQLCYVHCNLCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLP-ATNQLHFGHS 78 Query: 29 FF 24 F Sbjct: 79 IF 80 >ref|XP_002266233.1| PREDICTED: axial regulator YABBY 1 [Vitis vinifera] gi|297741152|emb|CBI31883.3| unnamed protein product [Vitis vinifera] Length = 211 Score = 120 bits (301), Expect = 1e-25 Identities = 55/62 (88%), Positives = 60/62 (96%) Frame = -3 Query: 209 EQLCYVHCNLCDTVLAVSVPCSSLYKTVTVRCGHCTNLLSVNMRGLLLPAASNQLHLGHA 30 EQLCYVHCN+CDTVLAVSVPC+SL+KTVTVRCGHCTNLL VN+RGLLLP+A NQLHLGHA Sbjct: 16 EQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNLRGLLLPSA-NQLHLGHA 74 Query: 29 FF 24 FF Sbjct: 75 FF 76