BLASTX nr result
ID: Papaver22_contig00031690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00031690 (552 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534269.1| Protein C20orf4, putative [Ricinus communis]... 56 3e-06 >ref|XP_002534269.1| Protein C20orf4, putative [Ricinus communis] gi|223525600|gb|EEF28112.1| Protein C20orf4, putative [Ricinus communis] Length = 409 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -2 Query: 245 YTLFGIYTQKFTVGLHFKGVKITPLASHFVYCSSSNKDG 129 YTLFGI TQ FTVG FKGVK+ P +HFVY SSS++DG Sbjct: 27 YTLFGIDTQVFTVGPAFKGVKMIPPGTHFVYYSSSSRDG 65