BLASTX nr result
ID: Papaver22_contig00031615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00031615 (428 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282776.1| PREDICTED: uncharacterized protein LOC100267... 64 1e-08 ref|XP_003533932.1| PREDICTED: uncharacterized protein LOC100787... 63 2e-08 ref|XP_003533094.1| PREDICTED: uncharacterized protein LOC100815... 63 2e-08 ref|XP_003523243.1| PREDICTED: uncharacterized protein LOC100526... 62 5e-08 ref|XP_002886172.1| DNAJ heat shock N-terminal domain-containing... 62 6e-08 >ref|XP_002282776.1| PREDICTED: uncharacterized protein LOC100267710 [Vitis vinifera] gi|296088617|emb|CBI37608.3| unnamed protein product [Vitis vinifera] Length = 285 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 427 HPDKHQGPSQAVAEEKFKVCNDAYKSLCNALSS 329 HPDKHQGPSQA AEEKFK+C +AYKSLCNALS+ Sbjct: 252 HPDKHQGPSQATAEEKFKLCVNAYKSLCNALST 284 >ref|XP_003533932.1| PREDICTED: uncharacterized protein LOC100787858 [Glycine max] Length = 262 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 427 HPDKHQGPSQAVAEEKFKVCNDAYKSLCNALS 332 HPDKHQGPSQA+AEEKFK+C +AYK+LCNALS Sbjct: 229 HPDKHQGPSQAMAEEKFKLCVNAYKTLCNALS 260 >ref|XP_003533094.1| PREDICTED: uncharacterized protein LOC100815841 [Glycine max] Length = 160 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 427 HPDKHQGPSQAVAEEKFKVCNDAYKSLCNALS 332 HPDKHQGPSQA+AEEKFK+C +AYK+LCNALS Sbjct: 127 HPDKHQGPSQAMAEEKFKLCVNAYKTLCNALS 158 >ref|XP_003523243.1| PREDICTED: uncharacterized protein LOC100526896 [Glycine max] Length = 263 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -2 Query: 427 HPDKHQGPSQAVAEEKFKVCNDAYKSLCNALS 332 HPDKHQGPSQA+AEEKFK+C +AYK+LCNAL+ Sbjct: 230 HPDKHQGPSQAMAEEKFKLCVNAYKTLCNALA 261 >ref|XP_002886172.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297332012|gb|EFH62431.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 268 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 427 HPDKHQGPSQAVAEEKFKVCNDAYKSLCNALS 332 HPDKHQGPSQA A+EKFK+C DAYKSLC+AL+ Sbjct: 237 HPDKHQGPSQAAAQEKFKLCVDAYKSLCSALA 268