BLASTX nr result
ID: Papaver22_contig00031421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00031421 (569 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI14812.1| chloroplast bromodomain-containing protein [Pachy... 57 2e-06 >gb|ABI14812.1| chloroplast bromodomain-containing protein [Pachysandra terminalis] Length = 428 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 259 DVDIGEDIPTSSFPPVEIEKDAGYASDKTGSGSN 158 DVDIGE+IPTS+FPPVEIEKDAGY S ++ S S+ Sbjct: 355 DVDIGEEIPTSNFPPVEIEKDAGYGSSRSSSSSS 388