BLASTX nr result
ID: Papaver22_contig00030690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00030690 (503 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA48561.1| TPA: hypothetical protein ZEAMMB73_178037 [Zea m... 122 3e-32 ref|NP_001146643.1| uncharacterized protein LOC100280242 [Zea ma... 122 3e-32 ref|XP_002509824.1| aminopeptidase, putative [Ricinus communis] ... 120 3e-32 tpg|DAA48563.1| TPA: hypothetical protein ZEAMMB73_178037 [Zea m... 122 3e-32 tpg|DAA48562.1| TPA: hypothetical protein ZEAMMB73_178037 [Zea m... 122 3e-32 >tpg|DAA48561.1| TPA: hypothetical protein ZEAMMB73_178037 [Zea mays] Length = 887 Score = 122 bits (307), Expect(2) = 3e-32 Identities = 59/67 (88%), Positives = 62/67 (92%) Frame = +2 Query: 2 PNKVRSLIGGFCASPVNFHAKDGSGYKFLGEIVLQLDKLNPQGASRMVSSLSRWRRYDET 181 PNKV SLIGGFC SPVNFHAKDGSGYKFLGEIVLQLDK+NPQ ASRMVS+ SRWRRYD+T Sbjct: 796 PNKVYSLIGGFCGSPVNFHAKDGSGYKFLGEIVLQLDKINPQVASRMVSAFSRWRRYDKT 855 Query: 182 RQAHAKA 202 RQA AKA Sbjct: 856 RQALAKA 862 Score = 40.8 bits (94), Expect(2) = 3e-32 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +3 Query: 273 EMILSTNGLSENVFEIASKSLA 338 EMI+S NGLSENVFEIASKSLA Sbjct: 865 EMIVSANGLSENVFEIASKSLA 886 >ref|NP_001146643.1| uncharacterized protein LOC100280242 [Zea mays] gi|219888157|gb|ACL54453.1| unknown [Zea mays] Length = 887 Score = 122 bits (307), Expect(2) = 3e-32 Identities = 59/67 (88%), Positives = 62/67 (92%) Frame = +2 Query: 2 PNKVRSLIGGFCASPVNFHAKDGSGYKFLGEIVLQLDKLNPQGASRMVSSLSRWRRYDET 181 PNKV SLIGGFC SPVNFHAKDGSGYKFLGEIVLQLDK+NPQ ASRMVS+ SRWRRYD+T Sbjct: 796 PNKVYSLIGGFCGSPVNFHAKDGSGYKFLGEIVLQLDKINPQVASRMVSAFSRWRRYDKT 855 Query: 182 RQAHAKA 202 RQA AKA Sbjct: 856 RQALAKA 862 Score = 40.8 bits (94), Expect(2) = 3e-32 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +3 Query: 273 EMILSTNGLSENVFEIASKSLA 338 EMI+S NGLSENVFEIASKSLA Sbjct: 865 EMIVSANGLSENVFEIASKSLA 886 >ref|XP_002509824.1| aminopeptidase, putative [Ricinus communis] gi|223549723|gb|EEF51211.1| aminopeptidase, putative [Ricinus communis] Length = 866 Score = 120 bits (301), Expect(2) = 3e-32 Identities = 57/67 (85%), Positives = 61/67 (91%) Frame = +2 Query: 2 PNKVRSLIGGFCASPVNFHAKDGSGYKFLGEIVLQLDKLNPQGASRMVSSLSRWRRYDET 181 PNKV SLIGGFC SPVNFHAKDGSGY+FLGEIV+QLDK+NPQ ASRMVS+ SRWRRYDET Sbjct: 775 PNKVYSLIGGFCGSPVNFHAKDGSGYQFLGEIVMQLDKINPQVASRMVSAFSRWRRYDET 834 Query: 182 RQAHAKA 202 RQ AKA Sbjct: 835 RQTLAKA 841 Score = 43.1 bits (100), Expect(2) = 3e-32 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 273 EMILSTNGLSENVFEIASKSLA 338 EMI+STNGLSENVFEIASKSLA Sbjct: 844 EMIMSTNGLSENVFEIASKSLA 865 >tpg|DAA48563.1| TPA: hypothetical protein ZEAMMB73_178037 [Zea mays] gi|414870007|tpg|DAA48564.1| TPA: hypothetical protein ZEAMMB73_178037 [Zea mays] gi|414870008|tpg|DAA48565.1| TPA: hypothetical protein ZEAMMB73_178037 [Zea mays] gi|414870009|tpg|DAA48566.1| TPA: hypothetical protein ZEAMMB73_178037 [Zea mays] Length = 495 Score = 122 bits (307), Expect(2) = 3e-32 Identities = 59/67 (88%), Positives = 62/67 (92%) Frame = +2 Query: 2 PNKVRSLIGGFCASPVNFHAKDGSGYKFLGEIVLQLDKLNPQGASRMVSSLSRWRRYDET 181 PNKV SLIGGFC SPVNFHAKDGSGYKFLGEIVLQLDK+NPQ ASRMVS+ SRWRRYD+T Sbjct: 404 PNKVYSLIGGFCGSPVNFHAKDGSGYKFLGEIVLQLDKINPQVASRMVSAFSRWRRYDKT 463 Query: 182 RQAHAKA 202 RQA AKA Sbjct: 464 RQALAKA 470 Score = 40.8 bits (94), Expect(2) = 3e-32 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +3 Query: 273 EMILSTNGLSENVFEIASKSLA 338 EMI+S NGLSENVFEIASKSLA Sbjct: 473 EMIVSANGLSENVFEIASKSLA 494 >tpg|DAA48562.1| TPA: hypothetical protein ZEAMMB73_178037 [Zea mays] Length = 490 Score = 122 bits (307), Expect(2) = 3e-32 Identities = 59/67 (88%), Positives = 62/67 (92%) Frame = +2 Query: 2 PNKVRSLIGGFCASPVNFHAKDGSGYKFLGEIVLQLDKLNPQGASRMVSSLSRWRRYDET 181 PNKV SLIGGFC SPVNFHAKDGSGYKFLGEIVLQLDK+NPQ ASRMVS+ SRWRRYD+T Sbjct: 399 PNKVYSLIGGFCGSPVNFHAKDGSGYKFLGEIVLQLDKINPQVASRMVSAFSRWRRYDKT 458 Query: 182 RQAHAKA 202 RQA AKA Sbjct: 459 RQALAKA 465 Score = 40.8 bits (94), Expect(2) = 3e-32 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +3 Query: 273 EMILSTNGLSENVFEIASKSLA 338 EMI+S NGLSENVFEIASKSLA Sbjct: 468 EMIVSANGLSENVFEIASKSLA 489