BLASTX nr result
ID: Papaver22_contig00030005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00030005 (673 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60544.1| hypothetical protein VITISV_006250 [Vitis vinifera] 56 6e-06 >emb|CAN60544.1| hypothetical protein VITISV_006250 [Vitis vinifera] Length = 833 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/63 (39%), Positives = 38/63 (60%) Frame = +3 Query: 324 KILVWNCRGAARPSFNRVMKKLIKRHKLNIVAFLETRVLAPHAAGIVRQLGYEESIVVDL 503 K+L WNCRGA F R +K LIK H+ +IV LE ++ A +++++G+ +D Sbjct: 668 KLLCWNCRGAGELKFMRAIKDLIKLHEPSIVVLLEPKISGGDADQVIKEIGFSGQYHIDP 727 Query: 504 EGF 512 EGF Sbjct: 728 EGF 730