BLASTX nr result
ID: Papaver22_contig00029888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00029888 (647 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66863.1| hypothetical protein VITISV_013500 [Vitis vinifera] 57 3e-06 gb|AAC61290.1| putative retroelement pol polyprotein [Arabidopsi... 57 4e-06 >emb|CAN66863.1| hypothetical protein VITISV_013500 [Vitis vinifera] Length = 1112 Score = 57.0 bits (136), Expect = 3e-06 Identities = 41/98 (41%), Positives = 52/98 (53%), Gaps = 1/98 (1%) Frame = +3 Query: 357 SQAGPSTLPTQAGGEWNFT-PSDPVWLPYFGATSHLTNNPAVLVDPQEFLGADLVMVGDG 533 SQ+ P P QA T P + WL GA+ H+T N L F G D +M+GDG Sbjct: 132 SQSRPPA-PWQAQANVTTTIPPNTTWLLDSGASHHVTTNLHNLALHSPFDGTDEIMIGDG 190 Query: 534 MTLPISLIGSSYLTPAASNFTFDLKNVLLVLHIKHNLL 647 LPIS GS+ LT + +FT L NVL V +K NL+ Sbjct: 191 FGLPISHTGSTSLTTPSHSFT--LSNVLCVPTMKRNLI 226 >gb|AAC61290.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1149 Score = 56.6 bits (135), Expect = 4e-06 Identities = 33/76 (43%), Positives = 45/76 (59%) Frame = +3 Query: 420 DPVWLPYFGATSHLTNNPAVLVDPQEFLGADLVMVGDGMTLPISLIGSSYLTPAASNFTF 599 D W+P AT+H+TNN + L Q +LG D VM DG LPI+ IGS+ L + N Sbjct: 311 DSGWVPDSAATAHITNNSSRLQQMQPYLGNDTVMASDGNFLPITHIGSANLPSTSGN--L 368 Query: 600 DLKNVLLVLHIKHNLL 647 LK+VL+ +I +LL Sbjct: 369 PLKDVLVCPNIAKSLL 384