BLASTX nr result
ID: Papaver22_contig00029789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00029789 (628 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63115.1| hypothetical protein 18.t00011 [Asparagus officin... 59 8e-08 gb|ABD63147.1| Integrase core domain containing protein [Asparag... 60 4e-07 >gb|ABD63115.1| hypothetical protein 18.t00011 [Asparagus officinalis] Length = 887 Score = 59.3 bits (142), Expect(2) = 8e-08 Identities = 33/85 (38%), Positives = 51/85 (60%), Gaps = 3/85 (3%) Frame = +2 Query: 146 ENLKLFEPSLLD-EREESPLLPTMHDLV--PSEAATEDYLLGKKTRMTQSGEQEFF*VCA 316 E LKLFEP LLD E ++ +LP + DL E ED +L +KT MT+ G +E F + Sbjct: 803 EYLKLFEPPLLDDEGDDKVILPHVEDLWFDREEPLNEDCILERKTIMTRRGTKESFLIRR 862 Query: 317 KGRYPNRAKWYSLEQVQKNFPHFLY 391 +G+ P++ KW++ E+ + FP + Sbjct: 863 QGQVPSKTKWFNRERGAREFPQLKF 887 Score = 22.7 bits (47), Expect(2) = 8e-08 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 103 KARLQGPNKKLKPL 144 K RL+G KKLKP+ Sbjct: 757 KERLKGEGKKLKPI 770 >gb|ABD63147.1| Integrase core domain containing protein [Asparagus officinalis] Length = 870 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = +1 Query: 7 LEKAQPKYKERHDKHRMQHTFQVGDSVWLYLGKARLQGPNKKLKPLR 147 L+K+Q KYK +HD+HR+ F GD VWL LGK RL+G KK KP+R Sbjct: 666 LKKSQAKYKVKHDQHRVPCNFGKGDMVWLKLGKERLKGEEKKSKPIR 712