BLASTX nr result
ID: Papaver22_contig00029714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00029714 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002312128.1| predicted protein [Populus trichocarpa] gi|2... 77 2e-12 ref|NP_199065.1| disease resistance-responsive, dirigent domain-... 74 1e-11 ref|XP_002299656.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 ref|XP_002863772.1| disease resistance-responsive family protein... 73 2e-11 ref|NP_199066.1| disease resistance-responsive, dirigent domain-... 73 3e-11 >ref|XP_002312128.1| predicted protein [Populus trichocarpa] gi|222851948|gb|EEE89495.1| predicted protein [Populus trichocarpa] Length = 187 Score = 76.6 bits (187), Expect = 2e-12 Identities = 39/67 (58%), Positives = 48/67 (71%), Gaps = 2/67 (2%) Frame = +1 Query: 16 FTGNEKFNGSTISVLSRNPVTHTEREFAIVGGTGYFQFARGFISAKTYSLVGPN--AVVE 189 FT E FNGS+ISV SRNP+ +TERE A+VGG G F+ ARGF KTY + N A+VE Sbjct: 121 FTTGE-FNGSSISVFSRNPIINTERELAVVGGRGKFRLARGFAQLKTYFINATNGDAIVE 179 Query: 190 YNCTIVH 210 YN T++H Sbjct: 180 YNVTVIH 186 >ref|NP_199065.1| disease resistance-responsive, dirigent domain-containing protein [Arabidopsis thaliana] gi|9759486|dbj|BAB10491.1| disease resistance response protein-like [Arabidopsis thaliana] gi|20260392|gb|AAM13094.1| unknown protein [Arabidopsis thaliana] gi|30725558|gb|AAP37801.1| At5g42500 [Arabidopsis thaliana] gi|332007434|gb|AED94817.1| disease resistance-responsive, dirigent domain-containing protein [Arabidopsis thaliana] Length = 185 Score = 73.9 bits (180), Expect = 1e-11 Identities = 37/68 (54%), Positives = 47/68 (69%) Frame = +1 Query: 7 SLVFTGNEKFNGSTISVLSRNPVTHTEREFAIVGGTGYFQFARGFISAKTYSLVGPNAVV 186 +L FT E FNGST+++ RN + RE I+GGTG F+FARG+ AKTY +VG +AVV Sbjct: 119 NLAFTAGE-FNGSTVAMYGRNEIFSKVREMPIIGGTGAFRFARGYAQAKTYKVVGLDAVV 177 Query: 187 EYNCTIVH 210 EYN I H Sbjct: 178 EYNVFIWH 185 >ref|XP_002299656.1| predicted protein [Populus trichocarpa] gi|222846914|gb|EEE84461.1| predicted protein [Populus trichocarpa] Length = 149 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/59 (54%), Positives = 45/59 (76%) Frame = +1 Query: 34 FNGSTISVLSRNPVTHTEREFAIVGGTGYFQFARGFISAKTYSLVGPNAVVEYNCTIVH 210 +NGST SVL RNP+ + RE +VGGTG F+ ARG+ AKT+S+VG +A++ YN T++H Sbjct: 91 YNGSTFSVLGRNPIMNEVREMPVVGGTGIFRLARGYCLAKTHSMVGFDAIIGYNVTLLH 149 >ref|XP_002863772.1| disease resistance-responsive family protein [Arabidopsis lyrata subsp. lyrata] gi|297791781|ref|XP_002863775.1| disease resistance-responsive family protein [Arabidopsis lyrata subsp. lyrata] gi|297309607|gb|EFH40031.1| disease resistance-responsive family protein [Arabidopsis lyrata subsp. lyrata] gi|297309610|gb|EFH40034.1| disease resistance-responsive family protein [Arabidopsis lyrata subsp. lyrata] Length = 185 Score = 73.2 bits (178), Expect = 2e-11 Identities = 37/68 (54%), Positives = 47/68 (69%) Frame = +1 Query: 7 SLVFTGNEKFNGSTISVLSRNPVTHTEREFAIVGGTGYFQFARGFISAKTYSLVGPNAVV 186 +L FT E FNGST+++ RN + RE I+GGTG F+FARG+ AKTY +VG +AVV Sbjct: 119 NLAFTEGE-FNGSTLAMYGRNDIFSKVREMPIIGGTGAFRFARGYAQAKTYKIVGLDAVV 177 Query: 187 EYNCTIVH 210 EYN I H Sbjct: 178 EYNVFIWH 185 >ref|NP_199066.1| disease resistance-responsive, dirigent domain-containing protein [Arabidopsis thaliana] gi|9759487|dbj|BAB10492.1| unnamed protein product [Arabidopsis thaliana] gi|149944325|gb|ABR46205.1| At5g42510 [Arabidopsis thaliana] gi|332007436|gb|AED94819.1| disease resistance-responsive, dirigent domain-containing protein [Arabidopsis thaliana] Length = 182 Score = 72.8 bits (177), Expect = 3e-11 Identities = 38/66 (57%), Positives = 45/66 (68%) Frame = +1 Query: 13 VFTGNEKFNGSTISVLSRNPVTHTEREFAIVGGTGYFQFARGFISAKTYSLVGPNAVVEY 192 VFT E FNGSTI+V RN + RE I+GGTG F+FARG+ KTY +VG +AVVEY Sbjct: 118 VFTAGE-FNGSTIAVYGRNDIFSKVRELPIIGGTGAFRFARGYALPKTYKIVGLDAVVEY 176 Query: 193 NCTIVH 210 N I H Sbjct: 177 NVFIWH 182