BLASTX nr result
ID: Papaver22_contig00029343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00029343 (630 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002979307.1| hypothetical protein SELMODRAFT_110454 [Sela... 57 4e-06 >ref|XP_002979307.1| hypothetical protein SELMODRAFT_110454 [Selaginella moellendorffii] gi|300153075|gb|EFJ19715.1| hypothetical protein SELMODRAFT_110454 [Selaginella moellendorffii] Length = 500 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +3 Query: 435 VWIFRLSTSILVWTGIIQLTSMVELWHPHLPKGWPTACIDR 557 VW+ R STSIL+WT IIQLT++ ELW HL K WP +C DR Sbjct: 14 VWLLRASTSILLWTCIIQLTALGELWRLHLVKRWP-SCFDR 53