BLASTX nr result
ID: Papaver22_contig00029126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00029126 (1334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA50234.1| nucleosome assembly protein I-like protein; simil... 60 1e-06 ref|XP_002869628.1| hypothetical protein ARALYDRAFT_492203 [Arab... 60 1e-06 ref|NP_001119060.1| nucleosome assembly protein 1-like 1 [Arabid... 60 1e-06 ref|NP_194341.1| nucleosome assembly protein 1-like 1 [Arabidops... 60 1e-06 ref|XP_002308283.1| nucleosome/chromatin assembly factor group [... 60 2e-06 >gb|AAA50234.1| nucleosome assembly protein I-like protein; similar to mouse nap I, PIR Accession Number JS0707, partial [Arabidopsis thaliana] Length = 382 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 101 VTSQKHMVLKYLKDIKWCRIEEPKGFKLEFFFD 3 VT + LKYLKDIKWC+IEEPKGFKLEFFFD Sbjct: 155 VTERDEGALKYLKDIKWCKIEEPKGFKLEFFFD 187 >ref|XP_002869628.1| hypothetical protein ARALYDRAFT_492203 [Arabidopsis lyrata subsp. lyrata] gi|297315464|gb|EFH45887.1| hypothetical protein ARALYDRAFT_492203 [Arabidopsis lyrata subsp. lyrata] Length = 376 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 101 VTSQKHMVLKYLKDIKWCRIEEPKGFKLEFFFD 3 VT + LKYLKDIKWC+IEEPKGFKLEFFFD Sbjct: 144 VTERDEGALKYLKDIKWCKIEEPKGFKLEFFFD 176 >ref|NP_001119060.1| nucleosome assembly protein 1-like 1 [Arabidopsis thaliana] gi|332659759|gb|AEE85159.1| nucleosome assembly protein 1-like 1 [Arabidopsis thaliana] Length = 359 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 101 VTSQKHMVLKYLKDIKWCRIEEPKGFKLEFFFD 3 VT + LKYLKDIKWC+IEEPKGFKLEFFFD Sbjct: 145 VTERDEGALKYLKDIKWCKIEEPKGFKLEFFFD 177 >ref|NP_194341.1| nucleosome assembly protein 1-like 1 [Arabidopsis thaliana] gi|4538940|emb|CAB39676.1| nucleosome assembly protein I-like protein [Arabidopsis thaliana] gi|7269462|emb|CAB79466.1| nucleosome assembly protein I-like protein [Arabidopsis thaliana] gi|15450808|gb|AAK96675.1| nucleosome assembly protein I-like protein [Arabidopsis thaliana] gi|20259870|gb|AAM13282.1| nucleosome assembly protein I-like protein [Arabidopsis thaliana] gi|332659758|gb|AEE85158.1| nucleosome assembly protein 1-like 1 [Arabidopsis thaliana] Length = 372 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 101 VTSQKHMVLKYLKDIKWCRIEEPKGFKLEFFFD 3 VT + LKYLKDIKWC+IEEPKGFKLEFFFD Sbjct: 145 VTERDEGALKYLKDIKWCKIEEPKGFKLEFFFD 177 >ref|XP_002308283.1| nucleosome/chromatin assembly factor group [Populus trichocarpa] gi|222854259|gb|EEE91806.1| nucleosome/chromatin assembly factor group [Populus trichocarpa] Length = 378 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 101 VTSQKHMVLKYLKDIKWCRIEEPKGFKLEFFFD 3 +T + LKYLKDIKWCRIE+PKGFKLEFFFD Sbjct: 143 ITERDEGALKYLKDIKWCRIEDPKGFKLEFFFD 175