BLASTX nr result
ID: Papaver22_contig00028318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00028318 (454 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631454.1| PREDICTED: aspartic proteinase nepenthesin-2... 58 7e-07 emb|CBI31923.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002528927.1| pepsin A, putative [Ricinus communis] gi|223... 58 7e-07 ref|XP_003611301.1| Aspartic proteinase nepenthesin-2 [Medicago ... 57 1e-06 ref|XP_002304273.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_003631454.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Vitis vinifera] Length = 485 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 4 GPAAALGNYQQQGFEVVYDLGQRKIGFAKKKC 99 GPAA LGNYQQQGFEVVYDL + ++GFA++KC Sbjct: 444 GPAATLGNYQQQGFEVVYDLEKHRVGFARRKC 475 >emb|CBI31923.3| unnamed protein product [Vitis vinifera] Length = 781 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 4 GPAAALGNYQQQGFEVVYDLGQRKIGFAKKKC 99 GPAA LGNYQQQGFEVVYDL + ++GFA++KC Sbjct: 299 GPAATLGNYQQQGFEVVYDLEKHRVGFARRKC 330 >ref|XP_002528927.1| pepsin A, putative [Ricinus communis] gi|223531629|gb|EEF33456.1| pepsin A, putative [Ricinus communis] Length = 493 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 4 GPAAALGNYQQQGFEVVYDLGQRKIGFAKKKC 99 GP A LGNYQQ GFEVVYDL QR++GFA++KC Sbjct: 452 GPGATLGNYQQHGFEVVYDLEQRRVGFARRKC 483 >ref|XP_003611301.1| Aspartic proteinase nepenthesin-2 [Medicago truncatula] gi|355512636|gb|AES94259.1| Aspartic proteinase nepenthesin-2 [Medicago truncatula] Length = 481 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 4 GPAAALGNYQQQGFEVVYDLGQRKIGFAKKKC 99 GP A LGNYQQQGFEVVYDL + ++GFAKK+C Sbjct: 438 GPGATLGNYQQQGFEVVYDLEKERVGFAKKEC 469 >ref|XP_002304273.1| predicted protein [Populus trichocarpa] gi|222841705|gb|EEE79252.1| predicted protein [Populus trichocarpa] Length = 496 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 4 GPAAALGNYQQQGFEVVYDLGQRKIGFAKKKC 99 GP A LGNYQQQGFEVVYDL R++GFA+++C Sbjct: 455 GPGATLGNYQQQGFEVVYDLENRRVGFARRQC 486