BLASTX nr result
ID: Papaver22_contig00028125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00028125 (634 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516199.1| fyve finger-containing phosphoinositide kina... 68 1e-09 ref|NP_188044.1| 1-phosphatidylinositol-4-phosphate 5-kinase [Ar... 67 2e-09 ref|XP_002882874.1| phosphatidylinositol-4-phosphate 5-kinase fa... 67 2e-09 ref|XP_003547898.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 67 3e-09 ref|XP_003529857.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 67 3e-09 >ref|XP_002516199.1| fyve finger-containing phosphoinositide kinase, fyv1, putative [Ricinus communis] gi|223544685|gb|EEF46201.1| fyve finger-containing phosphoinositide kinase, fyv1, putative [Ricinus communis] Length = 1821 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/55 (63%), Positives = 41/55 (74%), Gaps = 4/55 (7%) Frame = +3 Query: 3 FPPSPSDHRSILVSSS---IWKGAVCEQAHLLRINYHGSL-SPSGRSL*DNIFVQ 155 FPPSPSDH+SILVS S +WKG VCE+AHL RI Y+GS P GR L D++F Q Sbjct: 859 FPPSPSDHQSILVSLSTRCVWKGTVCERAHLFRIKYYGSFDKPLGRFLRDHLFDQ 913 >ref|NP_188044.1| 1-phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis thaliana] gi|9279575|dbj|BAB01033.1| unnamed protein product [Arabidopsis thaliana] gi|332641975|gb|AEE75496.1| 1-phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis thaliana] Length = 1791 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 4/55 (7%) Frame = +3 Query: 3 FPPSPSDHRSILVS---SSIWKGAVCEQAHLLRINYHGSL-SPSGRSL*DNIFVQ 155 FPPSPSDH+SILVS S+WKG VCE++HL RI Y+GS P GR L D++F Q Sbjct: 850 FPPSPSDHQSILVSLSSRSVWKGTVCERSHLFRIKYYGSFDKPLGRFLRDHLFDQ 904 >ref|XP_002882874.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297328714|gb|EFH59133.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 1789 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 4/55 (7%) Frame = +3 Query: 3 FPPSPSDHRSILVS---SSIWKGAVCEQAHLLRINYHGSL-SPSGRSL*DNIFVQ 155 FPPSPSDH+SILVS S+WKG VCE++HL RI Y+GS P GR L D++F Q Sbjct: 848 FPPSPSDHQSILVSLSSRSVWKGTVCERSHLFRIKYYGSFDKPLGRFLRDHLFDQ 902 >ref|XP_003547898.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase-like [Glycine max] Length = 1815 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 4/55 (7%) Frame = +3 Query: 3 FPPSPSDHRSILVSSS---IWKGAVCEQAHLLRINYHGSL-SPSGRSL*DNIFVQ 155 FPPSPSDH+SILVS S +WKG VCE++HL RI Y+GS P GR L D++F Q Sbjct: 864 FPPSPSDHQSILVSLSSRCVWKGTVCERSHLFRIKYYGSFDKPLGRFLRDHLFDQ 918 >ref|XP_003529857.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase-like [Glycine max] Length = 1825 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 4/55 (7%) Frame = +3 Query: 3 FPPSPSDHRSILVSSS---IWKGAVCEQAHLLRINYHGSL-SPSGRSL*DNIFVQ 155 FPPSPSDH+SILVS S +WKG VCE++HL RI Y+GS P GR L D++F Q Sbjct: 865 FPPSPSDHQSILVSLSSRCVWKGTVCERSHLFRIKYYGSFDKPLGRFLRDHLFDQ 919