BLASTX nr result
ID: Papaver22_contig00027892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00027892 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136023.1| PREDICTED: U3 small nucleolar RNA-associated... 58 9e-07 ref|XP_003553654.1| PREDICTED: U3 small nucleolar RNA-associated... 57 2e-06 >ref|XP_004136023.1| PREDICTED: U3 small nucleolar RNA-associated protein 14 homolog C-like [Cucumis sativus] gi|449498517|ref|XP_004160559.1| PREDICTED: U3 small nucleolar RNA-associated protein 14 homolog C-like [Cucumis sativus] Length = 904 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/47 (61%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = -1 Query: 455 VVKEPGVIIKPIEYEEVDPHGKSDEHKGKEKTQPKKN-KPDKGKSGR 318 VVK+ GVIIKPIE+EEVDPH K +EHK K + Q +KN K + GKS + Sbjct: 851 VVKKSGVIIKPIEFEEVDPHQKVEEHKQKGQKQKRKNGKTNHGKSAK 897 >ref|XP_003553654.1| PREDICTED: U3 small nucleolar RNA-associated protein 14 homolog A-like [Glycine max] Length = 883 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/52 (55%), Positives = 37/52 (71%), Gaps = 6/52 (11%) Frame = -1 Query: 455 VVKEPGVIIKPIEYEEVDPHGKSDEHKGKEKTQPKKNKPD------KGKSGR 318 VVK PGVIIKPIE+EEV+PH K+++ G +K + KKNK + KGK GR Sbjct: 830 VVKRPGVIIKPIEFEEVNPHEKTEQRSGGDKRKFKKNKVNADNPMKKGKVGR 881