BLASTX nr result
ID: Papaver22_contig00027409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00027409 (594 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA58964.1| TPA: hypothetical protein ZEAMMB73_587810 [Zea m... 70 2e-10 ref|NP_001145332.1| uncharacterized protein LOC100278657 [Zea ma... 70 2e-10 gb|ACF87217.1| unknown [Zea mays] 70 2e-10 ref|XP_002458151.1| hypothetical protein SORBIDRAFT_03g027800 [S... 70 3e-10 gb|AGG38108.1| maternal effect embryo arrest 18-3 protein [Dimoc... 69 5e-10 >tpg|DAA58964.1| TPA: hypothetical protein ZEAMMB73_587810 [Zea mays] Length = 480 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +1 Query: 172 PKVSLLKSSHDRETSGLSASGFITAVADALNRTYGDPQNCLKN 300 PK+ LL SHDRET+GLSASGF+TA+ D+LNRTYGDP LKN Sbjct: 362 PKILLLNGSHDRETAGLSASGFVTAITDSLNRTYGDPHKSLKN 404 >ref|NP_001145332.1| uncharacterized protein LOC100278657 [Zea mays] gi|195654749|gb|ACG46842.1| hypothetical protein [Zea mays] Length = 400 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +1 Query: 172 PKVSLLKSSHDRETSGLSASGFITAVADALNRTYGDPQNCLKN 300 PK+ LL SHDRET+GLSASGF+TA+ D+LNRTYGDP LKN Sbjct: 317 PKILLLNGSHDRETAGLSASGFVTAITDSLNRTYGDPHKSLKN 359 >gb|ACF87217.1| unknown [Zea mays] Length = 435 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +1 Query: 172 PKVSLLKSSHDRETSGLSASGFITAVADALNRTYGDPQNCLKN 300 PK+ LL SHDRET+GLSASGF+TA+ D+LNRTYGDP LKN Sbjct: 317 PKILLLNGSHDRETAGLSASGFVTAITDSLNRTYGDPHKSLKN 359 >ref|XP_002458151.1| hypothetical protein SORBIDRAFT_03g027800 [Sorghum bicolor] gi|241930126|gb|EES03271.1| hypothetical protein SORBIDRAFT_03g027800 [Sorghum bicolor] Length = 491 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 172 PKVSLLKSSHDRETSGLSASGFITAVADALNRTYGDPQNCLKN 300 PKV LL SHDRET+GLSASGF+TA+ D+LNRTYGDP LKN Sbjct: 367 PKVLLLNGSHDRETAGLSASGFVTAITDSLNRTYGDPHKRLKN 409 >gb|AGG38108.1| maternal effect embryo arrest 18-3 protein [Dimocarpus longan] Length = 139 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = +1 Query: 172 PKVSLLKSSHDRETSGLSASGFITAVADALNRTYGDPQNCLKN 300 PKV LL S DRETSG SAS F+TA+ DALNRTYGDPQN LKN Sbjct: 27 PKVLLLNGSLDRETSGFSASSFVTAITDALNRTYGDPQNSLKN 69