BLASTX nr result
ID: Papaver22_contig00027278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00027278 (2452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKD01989.1| hypothetical protein A1Q2_03689 [Trichosporon asa... 67 2e-08 gb|ELR20403.1| hypothetical protein ACA1_352610 [Acanthamoeba ca... 61 1e-06 >gb|EKD01989.1| hypothetical protein A1Q2_03689 [Trichosporon asahii var. asahii CBS 8904] Length = 1103 Score = 67.0 bits (162), Expect = 2e-08 Identities = 41/97 (42%), Positives = 55/97 (56%), Gaps = 1/97 (1%) Frame = -2 Query: 348 EYIASAPLIHLIKPGGGIRPIAVGIIWRRLCSKLATSSMCKDMTRYLGNHQFGVGIPCGS 169 + + ++ L L KPGGG+RPIAVG + RL K A + KD T L QFGVG P G Sbjct: 462 DLLCASSLTPLAKPGGGVRPIAVGSYFYRLIVKAALKA--KDSTPALLETQFGVGTPGGV 519 Query: 168 EGILHSANNLLELQGSQNNMTML-LVDFSNAFNLVDK 61 E ILH +L+ ++ T + +DF NAFN V + Sbjct: 520 EPILHWIEDLVSKTADDDDPTYITFLDFENAFNSVSR 556 >gb|ELR20403.1| hypothetical protein ACA1_352610 [Acanthamoeba castellanii str. Neff] Length = 1409 Score = 61.2 bits (147), Expect = 1e-06 Identities = 35/98 (35%), Positives = 54/98 (55%), Gaps = 4/98 (4%) Frame = -2 Query: 342 IASAPLIHLIKPGGGIRPIAVGIIWRRLCSKLATSS----MCKDMTRYLGNHQFGVGIPC 175 + ++ L+ L KP GG+RPIAVG R+ +L + D T+Y+G HQ+GV P Sbjct: 544 LTASRLVALKKPDGGVRPIAVGEALYRVIGRLVLKADRVMSSADATQYVGRHQYGVAYPG 603 Query: 174 GSEGILHSANNLLELQGSQNNMTMLLVDFSNAFNLVDK 61 G E +H+ EL S ++ +D+ NAFN +D+ Sbjct: 604 GVEAPVHAVR---ELHDSGQLRAVVSLDWRNAFNSLDR 638