BLASTX nr result
ID: Papaver22_contig00026491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00026491 (817 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591376.1| Werner syndrome ATP-dependent helicase [Medi... 52 5e-07 >ref|XP_003591376.1| Werner syndrome ATP-dependent helicase [Medicago truncatula] gi|355480424|gb|AES61627.1| Werner syndrome ATP-dependent helicase [Medicago truncatula] Length = 179 Score = 51.6 bits (122), Expect(2) = 5e-07 Identities = 26/56 (46%), Positives = 31/56 (55%) Frame = -3 Query: 548 STIATLHLCHGSHCFVIHLPRLDSIPNSLIRFLGDATIRFLRVDISQSFTKLAGEY 381 S ATLHLC+G C +I L LDS+P SL+ FL F+ V I KL EY Sbjct: 66 SECATLHLCNGQLCLIIQLCHLDSVPTSLLNFLRLPDYTFVSVGIKDDLAKLKKEY 121 Score = 28.5 bits (62), Expect(2) = 5e-07 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 688 NGISIVTIVTNDPSKVEVVLAELRVSVAATGDRVVGLDINFS 563 NG+ I T VTN +V+ +L G +V+G D+ S Sbjct: 10 NGVHIKTTVTNKQQEVDNLLWSFLRPANYNGPKVIGFDVELS 51