BLASTX nr result
ID: Papaver22_contig00026135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00026135 (720 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_199702.1| pentatricopeptide repeat-containing protein [Ar... 72 1e-10 ref|XP_002865693.1| pentatricopeptide repeat-containing protein ... 72 1e-10 ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [S... 71 2e-10 ref|XP_002320601.1| predicted protein [Populus trichocarpa] gi|2... 70 3e-10 >ref|NP_199702.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170778|sp|Q9FI80.1|PP425_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g48910 gi|10177180|dbj|BAB10314.1| selenium-binding protein-like [Arabidopsis thaliana] gi|15810559|gb|AAL07167.1| putative selenium-binding protein [Arabidopsis thaliana] gi|332008359|gb|AED95742.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 646 Score = 72.0 bits (175), Expect = 1e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 HSAIKLVSKVFKRKIVVRDRRRFHHFEDGFCSCNDYW 111 HS+IKL+SKV+KRKI VRDR+RFHHF+DG CSC DYW Sbjct: 610 HSSIKLISKVYKRKITVRDRKRFHHFQDGSCSCMDYW 646 >ref|XP_002865693.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297311528|gb|EFH41952.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 640 Score = 72.0 bits (175), Expect = 1e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 HSAIKLVSKVFKRKIVVRDRRRFHHFEDGFCSCNDYW 111 HS+IKL+SKV+KRKI VRDR+RFHHF+DG CSC DYW Sbjct: 604 HSSIKLISKVYKRKITVRDRKRFHHFQDGSCSCMDYW 640 >ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like, partial [Brachypodium distachyon] Length = 745 Score = 71.6 bits (174), Expect = 2e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 HSAIKLVSKVFKRKIVVRDRRRFHHFEDGFCSCNDYW 111 HSA KL+SKV+ R+I+VRDR RFHHF+DG CSCNDYW Sbjct: 709 HSATKLISKVYNREIIVRDRNRFHHFKDGLCSCNDYW 745 >ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] gi|241939236|gb|EES12381.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] Length = 693 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 1 HSAIKLVSKVFKRKIVVRDRRRFHHFEDGFCSCNDYW 111 HSA KL+SKV+ R+IVVRDR RFHHF+DG CSCNDYW Sbjct: 657 HSATKLISKVYNREIVVRDRNRFHHFKDGTCSCNDYW 693 >ref|XP_002320601.1| predicted protein [Populus trichocarpa] gi|222861374|gb|EEE98916.1| predicted protein [Populus trichocarpa] Length = 629 Score = 70.5 bits (171), Expect = 3e-10 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 1 HSAIKLVSKVFKRKIVVRDRRRFHHFEDGFCSCNDYW 111 HS+IKLVSK++ RKI+VRDR+RFHHFE+G CSC DYW Sbjct: 593 HSSIKLVSKIYNRKIIVRDRKRFHHFENGSCSCMDYW 629