BLASTX nr result
ID: Papaver22_contig00025947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00025947 (754 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF26763.1|AC007396_12 T4O12.24 [Arabidopsis thaliana] 61 2e-07 ref|XP_004144861.1| PREDICTED: V-type proton ATPase subunit B 1-... 58 2e-06 gb|AAC36485.1| nucleotide-binding subunit of vacuolar ATPase [Ar... 58 2e-06 gb|AAF26445.1| vacuolar H+-ATPase B subunit [Nicotiana tabacum] 58 2e-06 gb|AAF88162.1|AC026234_13 Nearly identical to vacuolar ATP synth... 58 2e-06 >gb|AAF26763.1|AC007396_12 T4O12.24 [Arabidopsis thaliana] Length = 520 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 646 LISQANYPTIKHIITPRIALTTTEHLAYECGKHVLV 753 L QAN PTI+ IITPRIALTT E+LAYECGKHVLV Sbjct: 270 LFQQANDPTIERIITPRIALTTAEYLAYECGKHVLV 305 >ref|XP_004144861.1| PREDICTED: V-type proton ATPase subunit B 1-like [Cucumis sativus] gi|449508811|ref|XP_004163418.1| PREDICTED: V-type proton ATPase subunit B 1-like [Cucumis sativus] Length = 488 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 649 ISQANYPTIKHIITPRIALTTTEHLAYECGKHVLV 753 ++ AN PTI+ IITPRIALTT E+LAYECGKHVLV Sbjct: 239 LNLANDPTIERIITPRIALTTAEYLAYECGKHVLV 273 >gb|AAC36485.1| nucleotide-binding subunit of vacuolar ATPase [Arabidopsis thaliana] Length = 492 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 649 ISQANYPTIKHIITPRIALTTTEHLAYECGKHVLV 753 ++ AN PTI+ IITPRIALTT E+LAYECGKHVLV Sbjct: 243 LNLANDPTIERIITPRIALTTAEYLAYECGKHVLV 277 >gb|AAF26445.1| vacuolar H+-ATPase B subunit [Nicotiana tabacum] Length = 486 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 649 ISQANYPTIKHIITPRIALTTTEHLAYECGKHVLV 753 ++ AN PTI+ IITPRIALTT E+LAYECGKHVLV Sbjct: 239 LNLANDPTIERIITPRIALTTAEYLAYECGKHVLV 273 >gb|AAF88162.1|AC026234_13 Nearly identical to vacuolar ATP synthase subunit B (V-atpase B subunit)(V-atpase 57 KD subunit) from Arabidopsis thaliana gi|137465 and is a member of ATP synthase alpha/beta PF|00006 family and contains an ATP synthase beta chain PF|01038 domain. ESTs gb|F14109, gb|AA650677, gb|N65767, gb|BE038735, gb|T88157, gb|F14079, gb|H76885, gb|N96777, gb|T14042 come from this gene [Arabidopsis thaliana] Length = 485 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 649 ISQANYPTIKHIITPRIALTTTEHLAYECGKHVLV 753 ++ AN PTI+ IITPRIALTT E+LAYECGKHVLV Sbjct: 238 LNLANDPTIERIITPRIALTTAEYLAYECGKHVLV 272