BLASTX nr result
ID: Papaver22_contig00025908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00025908 (749 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326389.1| cytochrome P450 [Populus trichocarpa] gi|222... 59 2e-07 >ref|XP_002326389.1| cytochrome P450 [Populus trichocarpa] gi|222833582|gb|EEE72059.1| cytochrome P450 [Populus trichocarpa] Length = 545 Score = 58.9 bits (141), Expect(2) = 2e-07 Identities = 34/51 (66%), Positives = 36/51 (70%), Gaps = 3/51 (5%) Frame = -3 Query: 297 ILVHVLRNYGTKYPKGLA--VAEFLFGYGLAIAEAPS-GRRALAVVPSLHR 154 I HVL+NYGTKY KGL V+EFLFG G AIAE P R AVVPSLHR Sbjct: 120 IAKHVLKNYGTKYAKGLVAEVSEFLFGSGFAIAEGPLWTARRRAVVPSLHR 170 Score = 21.9 bits (45), Expect(2) = 2e-07 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 136 FCKCAESLV 110 FCKCAE LV Sbjct: 181 FCKCAERLV 189