BLASTX nr result
ID: Papaver22_contig00025655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00025655 (492 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531465.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002531465.1| conserved hypothetical protein [Ricinus communis] gi|223528919|gb|EEF30915.1| conserved hypothetical protein [Ricinus communis] Length = 565 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/56 (46%), Positives = 32/56 (57%) Frame = +3 Query: 324 NPPSKFFSHXXXXXXXXXXXXXXXXXXXXQAPEFVSQTILTRSWELVHLLFVGIAV 491 N PSKF+SH QAPEF++QT+ TR WE +HL+FVGIAV Sbjct: 21 NNPSKFYSHFLYKALIVTIFLVILPLFPSQAPEFINQTLNTRGWEFLHLIFVGIAV 76