BLASTX nr result
ID: Papaver22_contig00024976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00024976 (1402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326344.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-07 ref|XP_002519556.1| conserved hypothetical protein [Ricinus comm... 61 6e-07 ref|XP_003553543.1| PREDICTED: uncharacterized protein LOC100786... 60 2e-06 ref|XP_003632609.1| PREDICTED: uncharacterized protein LOC100854... 59 3e-06 >ref|XP_002326344.1| predicted protein [Populus trichocarpa] gi|222833537|gb|EEE72014.1| predicted protein [Populus trichocarpa] Length = 167 Score = 61.6 bits (148), Expect = 5e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -3 Query: 1397 DLEYEEVKGFMDLGFRFDKEQICPRMMSVIPGLQRLSL 1284 +LE EEVKGFMDLGF F KE + PRMMSV+PGLQRL L Sbjct: 46 ELELEEVKGFMDLGFIFKKEYLSPRMMSVVPGLQRLGL 83 >ref|XP_002519556.1| conserved hypothetical protein [Ricinus communis] gi|223541419|gb|EEF42970.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 61.2 bits (147), Expect = 6e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -3 Query: 1397 DLEYEEVKGFMDLGFRFDKEQICPRMMSVIPGLQRLSL 1284 +LE EEVKGFMDLGF F KEQI PRM+SV+PGL RL L Sbjct: 53 ELELEEVKGFMDLGFIFKKEQISPRMISVVPGLSRLGL 90 >ref|XP_003553543.1| PREDICTED: uncharacterized protein LOC100786645 [Glycine max] Length = 259 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 1397 DLEYEEVKGFMDLGFRFDKEQICPRMMSVIPGLQRLSL 1284 +LE +EVKGFMDLGF F KE + PRMMSVIPGLQRL + Sbjct: 151 ELELDEVKGFMDLGFTFKKECLSPRMMSVIPGLQRLGV 188 >ref|XP_003632609.1| PREDICTED: uncharacterized protein LOC100854914 [Vitis vinifera] gi|297741575|emb|CBI32707.3| unnamed protein product [Vitis vinifera] Length = 267 Score = 58.9 bits (141), Expect = 3e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 1397 DLEYEEVKGFMDLGFRFDKEQICPRMMSVIPGLQRL 1290 +LE EEVKGFMDLGF+F +E + PRM++VIPGLQRL Sbjct: 146 ELELEEVKGFMDLGFKFKREHLSPRMITVIPGLQRL 181