BLASTX nr result
ID: Papaver22_contig00024628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00024628 (538 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263684.2| PREDICTED: uncharacterized sodium-dependent ... 76 3e-12 emb|CAN79649.1| hypothetical protein VITISV_010852 [Vitis vinifera] 76 3e-12 ref|XP_002320573.1| bile acid:Na+ symporter family protein [Popu... 74 1e-11 ref|XP_002527259.1| sodium-bile acid cotransporter, putative [Ri... 74 1e-11 ref|XP_004150363.1| PREDICTED: probable sodium/metabolite cotran... 64 1e-08 >ref|XP_002263684.2| PREDICTED: uncharacterized sodium-dependent transporter yocS-like [Vitis vinifera] gi|297742832|emb|CBI35586.3| unnamed protein product [Vitis vinifera] Length = 411 Score = 76.3 bits (186), Expect = 3e-12 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -3 Query: 536 VPPACSVVTMAIMGLCLASFWGNDYRIRDLPRLFLPQTGSTVE 408 VPPACSVV MAIMGL LASFWGN RIRDLP L LPQTGSTVE Sbjct: 367 VPPACSVVAMAIMGLSLASFWGNGGRIRDLPSLLLPQTGSTVE 409 >emb|CAN79649.1| hypothetical protein VITISV_010852 [Vitis vinifera] Length = 231 Score = 76.3 bits (186), Expect = 3e-12 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -3 Query: 536 VPPACSVVTMAIMGLCLASFWGNDYRIRDLPRLFLPQTGSTVE 408 VPPACSVV MAIMGL LASFWGN RIRDLP L LPQTGSTVE Sbjct: 187 VPPACSVVAMAIMGLSLASFWGNGGRIRDLPSLLLPQTGSTVE 229 >ref|XP_002320573.1| bile acid:Na+ symporter family protein [Populus trichocarpa] gi|222861346|gb|EEE98888.1| bile acid:Na+ symporter family protein [Populus trichocarpa] Length = 417 Score = 74.3 bits (181), Expect = 1e-11 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -3 Query: 536 VPPACSVVTMAIMGLCLASFWGNDYRIRDLPRLFLPQTGSTVE 408 VPPACSVV MAIMGLCLASFWGN YRIRD+P +PQ GS V+ Sbjct: 374 VPPACSVVAMAIMGLCLASFWGNGYRIRDIPSYLIPQFGSAVK 416 >ref|XP_002527259.1| sodium-bile acid cotransporter, putative [Ricinus communis] gi|223533352|gb|EEF35103.1| sodium-bile acid cotransporter, putative [Ricinus communis] Length = 356 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = -3 Query: 536 VPPACSVVTMAIMGLCLASFWGNDYRIRDLPRLFLPQTGSTVE 408 VPPACSVV MAIMGL LASFWGN YRIRDLP L PQ GSTV+ Sbjct: 313 VPPACSVVAMAIMGLSLASFWGNGYRIRDLPSLLTPQFGSTVK 355 >ref|XP_004150363.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic-like [Cucumis sativus] Length = 433 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 536 VPPACSVVTMAIMGLCLASFWGNDYRIRDLPRLFLPQTGS 417 VPPACSVV MAIMGLCLASFWG+ +IRDLP L + +T S Sbjct: 390 VPPACSVVVMAIMGLCLASFWGSGSKIRDLPSLLVQKTSS 429