BLASTX nr result
ID: Papaver22_contig00024433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00024433 (496 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002987016.1| hypothetical protein SELMODRAFT_125254 [Sela... 59 5e-07 emb|CBX24443.1| hypothetical_protein [Oryza glaberrima] 58 9e-07 ref|XP_002985001.1| hypothetical protein SELMODRAFT_424142 [Sela... 58 9e-07 gb|ACJ85533.1| unknown [Medicago truncatula] 56 3e-06 emb|CBX25493.1| hypothetical_protein [Oryza glaberrima] 56 3e-06 >ref|XP_002987016.1| hypothetical protein SELMODRAFT_125254 [Selaginella moellendorffii] gi|300145181|gb|EFJ11859.1| hypothetical protein SELMODRAFT_125254 [Selaginella moellendorffii] Length = 563 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/35 (88%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = -1 Query: 454 DVEHTHLVKGLDYALLNKVRSEI-KKP*EREEDEE 353 DVEHTHLVKGLDYALLNKVRSEI KKP E EE EE Sbjct: 82 DVEHTHLVKGLDYALLNKVRSEIDKKPEELEEPEE 116 >emb|CBX24443.1| hypothetical_protein [Oryza glaberrima] Length = 511 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -1 Query: 454 DVEHTHLVKGLDYALLNKVRSEIKKP*EREEDEETHFRNSCRW 326 D+EHTHLVKGLDYALL+KVRSEI+K + E+ ++T R+ +W Sbjct: 64 DLEHTHLVKGLDYALLHKVRSEIEKKPDAEDGKDTQTRSVYKW 106 >ref|XP_002985001.1| hypothetical protein SELMODRAFT_424142 [Selaginella moellendorffii] gi|300147211|gb|EFJ13876.1| hypothetical protein SELMODRAFT_424142 [Selaginella moellendorffii] Length = 474 Score = 57.8 bits (138), Expect = 9e-07 Identities = 31/41 (75%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -1 Query: 460 SCDVEHTHLVKGLDYALLNKVRSEI-KKP*EREEDEETHFR 341 S DVEHTHLVKGLDYALLNKVRSEI KKP E E+ E R Sbjct: 119 SSDVEHTHLVKGLDYALLNKVRSEIDKKPEEFEQQAEEEIR 159 >gb|ACJ85533.1| unknown [Medicago truncatula] Length = 215 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 454 DVEHTHLVKGLDYALLNKVRSEIKKP 377 DVEHTHLVKGLDYALLNKVRSEIKKP Sbjct: 80 DVEHTHLVKGLDYALLNKVRSEIKKP 105 >emb|CBX25493.1| hypothetical_protein [Oryza glaberrima] Length = 567 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -1 Query: 454 DVEHTHLVKGLDYALLNKVRSEIKKP*EREEDEETHFRNS 335 D+EHTHLVKGLDYALL+KVRSEI+K E E+ ++T R++ Sbjct: 80 DLEHTHLVKGLDYALLHKVRSEIEKKPEAEDGKDTQSRST 119