BLASTX nr result
ID: Papaver22_contig00024083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00024083 (659 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324564.1| autoinhibited H+ ATPase [Populus trichocarpa... 62 1e-07 ref|XP_002309321.1| autoinhibited H+ ATPase [Populus trichocarpa... 60 4e-07 emb|CAB85494.1| H+-ATPase [Medicago truncatula] 60 4e-07 emb|CAB85495.1| H+-ATPase [Medicago truncatula] 60 4e-07 ref|XP_002307856.1| autoinhibited H+ ATPase [Populus trichocarpa... 60 5e-07 >ref|XP_002324564.1| autoinhibited H+ ATPase [Populus trichocarpa] gi|222865998|gb|EEF03129.1| autoinhibited H+ ATPase [Populus trichocarpa] Length = 949 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -1 Query: 386 PKKKKREHRGSRELIVLLPLFDPPRHDSAETVRRAPDLGVSVK 258 P+K K G E + LLPLFDPPRHDSAET+RRA DLGV+VK Sbjct: 468 PEKNKESEGGPWEFVGLLPLFDPPRHDSAETIRRALDLGVNVK 510 >ref|XP_002309321.1| autoinhibited H+ ATPase [Populus trichocarpa] gi|222855297|gb|EEE92844.1| autoinhibited H+ ATPase [Populus trichocarpa] Length = 949 Score = 60.1 bits (144), Expect = 4e-07 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -1 Query: 392 RKPKKKKREHRGSRELIVLLPLFDPPRHDSAETVRRAPDLGVSVK 258 R P+K K E + LLPLFDPPRHDSAET+RRA DLGV+VK Sbjct: 466 RIPEKTKESEGAPWEFVGLLPLFDPPRHDSAETIRRALDLGVNVK 510 >emb|CAB85494.1| H+-ATPase [Medicago truncatula] Length = 965 Score = 60.1 bits (144), Expect = 4e-07 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -1 Query: 386 PKKKKREHRGSRELIVLLPLFDPPRHDSAETVRRAPDLGVSVK 258 P+ K G E + LLPLFDPPRHDSAET+RRA DLGVSVK Sbjct: 476 PEGSKDSPGGPWEFVALLPLFDPPRHDSAETIRRALDLGVSVK 518 >emb|CAB85495.1| H+-ATPase [Medicago truncatula] Length = 966 Score = 60.1 bits (144), Expect = 4e-07 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -1 Query: 386 PKKKKREHRGSRELIVLLPLFDPPRHDSAETVRRAPDLGVSVK 258 P+ K G E + LLPLFDPPRHDSAET+RRA DLGVSVK Sbjct: 476 PEGSKDSPGGPWEFVALLPLFDPPRHDSAETIRRALDLGVSVK 518 >ref|XP_002307856.1| autoinhibited H+ ATPase [Populus trichocarpa] gi|222853832|gb|EEE91379.1| autoinhibited H+ ATPase [Populus trichocarpa] Length = 944 Score = 59.7 bits (143), Expect = 5e-07 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -1 Query: 392 RKPKKKKREHRGSRELIVLLPLFDPPRHDSAETVRRAPDLGVSVK 258 R P+K K E + LLPLFDPPRHDSAET+RRA DLGV+VK Sbjct: 461 RIPEKNKESAGAPWEFVGLLPLFDPPRHDSAETIRRALDLGVNVK 505