BLASTX nr result
ID: Papaver22_contig00023258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00023258 (774 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP73615.1| asynapsis 1 [Hordeum vulgare subsp. vulgare] 71 8e-11 ref|XP_002514918.1| protein with unknown function [Ricinus commu... 71 2e-10 gb|ABR20128.1| asynapsis 1 [Triticum aestivum] 69 2e-10 ref|XP_003578389.1| PREDICTED: uncharacterized protein LOC100842... 69 5e-10 tpg|DAA40482.1| TPA: putative protein kinase superfamily protein... 67 3e-09 >gb|AFP73615.1| asynapsis 1 [Hordeum vulgare subsp. vulgare] Length = 592 Score = 70.9 bits (172), Expect(2) = 8e-11 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = -1 Query: 726 NDEGYLYMKALCHVLPLDYITISKLQSKLEGEVNQATLRKLLSKMACGGYVE 571 ND +YMKAL H LP+DY+T++KLQ KL+GE NQ+T+RKL+ KM GY++ Sbjct: 386 NDGDLMYMKALYHALPMDYVTVAKLQGKLDGEANQSTVRKLIDKMVQDGYIK 437 Score = 21.9 bits (45), Expect(2) = 8e-11 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 541 ELTDEKLPEIKNALEIKLS 485 E+T+ KL EIK LE+ ++ Sbjct: 452 EVTNRKLLEIKKILEVDIT 470 >ref|XP_002514918.1| protein with unknown function [Ricinus communis] gi|223545969|gb|EEF47472.1| protein with unknown function [Ricinus communis] Length = 613 Score = 71.2 bits (173), Expect = 2e-10 Identities = 30/52 (57%), Positives = 43/52 (82%) Frame = -1 Query: 720 EGYLYMKALCHVLPLDYITISKLQSKLEGEVNQATLRKLLSKMACGGYVEAK 565 + ++YMKAL H LP++Y+T++KLQ+KL+GE NQ T+RKL+ KM GY+EAK Sbjct: 395 DDHMYMKALYHALPMNYVTVAKLQTKLDGEANQTTVRKLIDKMTRDGYLEAK 446 >gb|ABR20128.1| asynapsis 1 [Triticum aestivum] Length = 588 Score = 68.9 bits (167), Expect(2) = 2e-10 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -1 Query: 726 NDEGYLYMKALCHVLPLDYITISKLQSKLEGEVNQATLRKLLSKMACGGYVE 571 N +YMKAL H LP+DY+TI+KLQ KL+GE NQ+T+RKL+ KM GY++ Sbjct: 387 NSGDLMYMKALYHALPMDYVTIAKLQGKLDGEANQSTVRKLMDKMVQDGYIK 438 Score = 22.3 bits (46), Expect(2) = 2e-10 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 595 DGLWWICGSQELTKTSRY-ELTDEKLPEIKNALEIKLS 485 DG G++ L K + E+T+ KL EIK LE+ ++ Sbjct: 434 DGYIKNSGNRRLGKAVIHSEVTNRKLLEIKKILEVDIT 471 >ref|XP_003578389.1| PREDICTED: uncharacterized protein LOC100842600 [Brachypodium distachyon] Length = 602 Score = 68.9 bits (167), Expect(2) = 5e-10 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -1 Query: 726 NDEGYLYMKALCHVLPLDYITISKLQSKLEGEVNQATLRKLLSKMACGGYVE 571 N+ +YMKAL H LP+DY+TI+KLQ KL+GE NQ T+RKL+ KM GY++ Sbjct: 386 NNRDLMYMKALYHALPMDYVTIAKLQGKLDGEANQNTVRKLIDKMVQDGYIK 437 Score = 21.2 bits (43), Expect(2) = 5e-10 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 541 ELTDEKLPEIKNALEIKL 488 E T+ KL EIK LE+ + Sbjct: 452 EATNRKLLEIKKILEVNI 469 >tpg|DAA40482.1| TPA: putative protein kinase superfamily protein [Zea mays] Length = 881 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -1 Query: 726 NDEGYLYMKALCHVLPLDYITISKLQSKLEGEVNQATLRKLLSKMACGGYVE 571 N+ LYMKAL H LP+DY+TI+KLQ KL+GE +Q T+RKL+ KM GYV+ Sbjct: 662 NNGDLLYMKALYHALPMDYVTIAKLQGKLDGEASQNTVRKLIDKMVQDGYVK 713