BLASTX nr result
ID: Papaver22_contig00022926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00022926 (557 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525958.1| Cell division protease ftsH, putative [Ricin... 79 6e-13 ref|XP_002884320.1| hypothetical protein ARALYDRAFT_896213 [Arab... 77 2e-12 ref|NP_186894.1| putative cell division protein ftsH [Arabidopsi... 75 7e-12 gb|AAM64694.1| cell division protein FtsH-like protein [Arabidop... 75 7e-12 ref|XP_002279064.2| PREDICTED: ATP-dependent zinc metalloproteas... 73 3e-11 >ref|XP_002525958.1| Cell division protease ftsH, putative [Ricinus communis] gi|223534690|gb|EEF36382.1| Cell division protease ftsH, putative [Ricinus communis] Length = 636 Score = 78.6 bits (192), Expect = 6e-13 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = -2 Query: 556 GGEAVAREDIMQAIERAKFGINGKQLTPSALKEELGKLFPWMPSLGKGNKT 404 GGE V REDIM+AIERAKFGIN +QL P+A+ +ELGKLFPW+PSL + N T Sbjct: 571 GGETVTREDIMEAIERAKFGINDRQLGPTAISKELGKLFPWIPSLMRRNNT 621 >ref|XP_002884320.1| hypothetical protein ARALYDRAFT_896213 [Arabidopsis lyrata subsp. lyrata] gi|297330160|gb|EFH60579.1| hypothetical protein ARALYDRAFT_896213 [Arabidopsis lyrata subsp. lyrata] Length = 616 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -2 Query: 556 GGEAVAREDIMQAIERAKFGINGKQLTPSALKEELGKLFPWMPSLGKGN 410 GGEAVAREDIM+AIERAKFGIN K++ P L EL KLFPWMPSL + N Sbjct: 551 GGEAVAREDIMEAIERAKFGINDKEVRPRTLGNELSKLFPWMPSLARRN 599 >ref|NP_186894.1| putative cell division protein ftsH [Arabidopsis thaliana] gi|6957708|gb|AAF32452.1| cell division protein FtsH-like protein [Arabidopsis thaliana] gi|17065470|gb|AAL32889.1| cell division protein FtsH-like protein [Arabidopsis thaliana] gi|30725442|gb|AAP37743.1| At3g02450 [Arabidopsis thaliana] gi|332640288|gb|AEE73809.1| putative cell division protein ftsH [Arabidopsis thaliana] Length = 622 Score = 75.1 bits (183), Expect = 7e-12 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = -2 Query: 556 GGEAVAREDIMQAIERAKFGINGKQLTPSALKEELGKLFPWMPSLGKGN 410 GGEAVAREDIM+AIERAKFGIN K+ P L EL K+FPWMPSL + N Sbjct: 557 GGEAVAREDIMEAIERAKFGINDKEARPRTLGNELSKMFPWMPSLARRN 605 >gb|AAM64694.1| cell division protein FtsH-like protein [Arabidopsis thaliana] Length = 622 Score = 75.1 bits (183), Expect = 7e-12 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = -2 Query: 556 GGEAVAREDIMQAIERAKFGINGKQLTPSALKEELGKLFPWMPSLGKGN 410 GGEAVAREDIM+AIERAKFGIN K+ P L EL K+FPWMPSL + N Sbjct: 557 GGEAVAREDIMEAIERAKFGINDKEARPRTLGNELSKMFPWMPSLARRN 605 >ref|XP_002279064.2| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like [Vitis vinifera] Length = 612 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = -2 Query: 556 GGEAVAREDIMQAIERAKFGINGKQLTPSALKEELGKLFPWMPSLGKGNKTRE 398 GGE+V REDIM+AIERA+FGIN KQ PS + EL KLFPWMPSL +R+ Sbjct: 547 GGESVTREDIMEAIERARFGINDKQSNPSTISRELRKLFPWMPSLMGSQDSRQ 599