BLASTX nr result
ID: Papaver22_contig00021724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00021724 (764 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271436.2| PREDICTED: uncharacterized protein LOC100245... 60 5e-07 >ref|XP_002271436.2| PREDICTED: uncharacterized protein LOC100245309 [Vitis vinifera] Length = 432 Score = 60.1 bits (144), Expect = 5e-07 Identities = 34/73 (46%), Positives = 42/73 (57%), Gaps = 2/73 (2%) Frame = +3 Query: 552 GASSIAMPSK--ETEDKSLPASVAPSVDTSYDGGDSSKVPETPESPEKEELLPIVPTIVQ 725 G SS + S+ E ED+ LP+S APS +TS +G + K E PE EK+ P P V Sbjct: 355 GLSSTLVGSEVLENEDEPLPSSDAPSFETS-NGAEHVKNSEVPECSEKQPPAPSAPRAVH 413 Query: 726 PASWKSCCGLFDV 764 SW CCGLFDV Sbjct: 414 KTSWMGCCGLFDV 426