BLASTX nr result
ID: Papaver22_contig00021005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00021005 (1870 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280545.1| PREDICTED: exocyst complex component 7 isofo... 48 5e-13 emb|CAN73810.1| hypothetical protein VITISV_039782 [Vitis vinifera] 48 5e-13 ref|XP_003632655.1| PREDICTED: exocyst complex component 7 isofo... 48 5e-13 ref|XP_002268110.1| PREDICTED: exocyst complex component 7 [Viti... 48 2e-12 emb|CBI25018.3| unnamed protein product [Vitis vinifera] 48 2e-12 >ref|XP_002280545.1| PREDICTED: exocyst complex component 7 isoform 1 [Vitis vinifera] gi|297740200|emb|CBI30382.3| unnamed protein product [Vitis vinifera] Length = 648 Score = 47.8 bits (112), Expect(3) = 5e-13 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 1558 IEMIFEGKACTEMRESALSLSKRLAQTSRK 1469 IE IFEG+AC EMRES+LSL+KRLAQT+++ Sbjct: 358 IETIFEGQACVEMRESSLSLTKRLAQTAQE 387 Score = 47.4 bits (111), Expect(3) = 5e-13 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = -2 Query: 1428 ETVVLDGTVHPLMSYVVNYVKFIFEW 1351 +T VLDGTVHPL SYV+NYVKF+F++ Sbjct: 402 KTAVLDGTVHPLTSYVINYVKFLFDY 427 Score = 26.6 bits (57), Expect(3) = 5e-13 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 1475 QETYGHS*EAVEKDATR 1425 QET+G EAVEKDAT+ Sbjct: 386 QETFGDFEEAVEKDATK 402 >emb|CAN73810.1| hypothetical protein VITISV_039782 [Vitis vinifera] Length = 643 Score = 47.8 bits (112), Expect(3) = 5e-13 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 1558 IEMIFEGKACTEMRESALSLSKRLAQTSRK 1469 IE IFEG+AC EMRES+LSL+KRLAQT+++ Sbjct: 358 IETIFEGQACVEMRESSLSLTKRLAQTAQE 387 Score = 47.4 bits (111), Expect(3) = 5e-13 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = -2 Query: 1428 ETVVLDGTVHPLMSYVVNYVKFIFEW 1351 +T VLDGTVHPL SYV+NYVKF+F++ Sbjct: 402 KTAVLDGTVHPLTSYVINYVKFLFDY 427 Score = 26.6 bits (57), Expect(3) = 5e-13 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 1475 QETYGHS*EAVEKDATR 1425 QET+G EAVEKDAT+ Sbjct: 386 QETFGDFEEAVEKDATK 402 >ref|XP_003632655.1| PREDICTED: exocyst complex component 7 isoform 2 [Vitis vinifera] Length = 640 Score = 47.8 bits (112), Expect(3) = 5e-13 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 1558 IEMIFEGKACTEMRESALSLSKRLAQTSRK 1469 IE IFEG+AC EMRES+LSL+KRLAQT+++ Sbjct: 358 IETIFEGQACVEMRESSLSLTKRLAQTAQE 387 Score = 47.4 bits (111), Expect(3) = 5e-13 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = -2 Query: 1428 ETVVLDGTVHPLMSYVVNYVKFIFEW 1351 +T VLDGTVHPL SYV+NYVKF+F++ Sbjct: 402 KTAVLDGTVHPLTSYVINYVKFLFDY 427 Score = 26.6 bits (57), Expect(3) = 5e-13 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 1475 QETYGHS*EAVEKDATR 1425 QET+G EAVEKDAT+ Sbjct: 386 QETFGDFEEAVEKDATK 402 >ref|XP_002268110.1| PREDICTED: exocyst complex component 7 [Vitis vinifera] Length = 650 Score = 47.8 bits (112), Expect(3) = 2e-12 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 1558 IEMIFEGKACTEMRESALSLSKRLAQTSRK 1469 IE IF+GKACTE+RESAL L+KRLAQT+++ Sbjct: 358 IETIFKGKACTEIRESALGLTKRLAQTAQE 387 Score = 45.1 bits (105), Expect(3) = 2e-12 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = -2 Query: 1428 ETVVLDGTVHPLMSYVVNYVKFIFEW 1351 +T V DGTVHPL SYV+NYVKF+F++ Sbjct: 402 KTAVSDGTVHPLTSYVINYVKFLFDY 427 Score = 26.6 bits (57), Expect(3) = 2e-12 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 1475 QETYGHS*EAVEKDATR 1425 QET+G EAVEKDAT+ Sbjct: 386 QETFGDFEEAVEKDATK 402 >emb|CBI25018.3| unnamed protein product [Vitis vinifera] Length = 644 Score = 47.8 bits (112), Expect(3) = 2e-12 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 1558 IEMIFEGKACTEMRESALSLSKRLAQTSRK 1469 IE IF+GKACTE+RESAL L+KRLAQT+++ Sbjct: 352 IETIFKGKACTEIRESALGLTKRLAQTAQE 381 Score = 45.1 bits (105), Expect(3) = 2e-12 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = -2 Query: 1428 ETVVLDGTVHPLMSYVVNYVKFIFEW 1351 +T V DGTVHPL SYV+NYVKF+F++ Sbjct: 396 KTAVSDGTVHPLTSYVINYVKFLFDY 421 Score = 26.6 bits (57), Expect(3) = 2e-12 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 1475 QETYGHS*EAVEKDATR 1425 QET+G EAVEKDAT+ Sbjct: 380 QETFGDFEEAVEKDATK 396