BLASTX nr result
ID: Papaver22_contig00019952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00019952 (498 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166877.1| PREDICTED: uncharacterized LOC101205354 [Cuc... 66 3e-09 ref|XP_004145472.1| PREDICTED: uncharacterized protein LOC101205... 66 3e-09 emb|CAN64638.1| hypothetical protein VITISV_033929 [Vitis vinifera] 61 8e-08 ref|XP_002530358.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_004166877.1| PREDICTED: uncharacterized LOC101205354 [Cucumis sativus] Length = 862 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = +1 Query: 70 ASSDGFNFNIASKYSLYLFDTRKPLSPVLQWAHNLDEPTYMQVF 201 A SDGF F+IAS + L L D RKPLSPVLQW H LD+P+YM VF Sbjct: 299 AGSDGFYFSIASNHLLLLCDIRKPLSPVLQWTHGLDDPSYMNVF 342 >ref|XP_004145472.1| PREDICTED: uncharacterized protein LOC101205354 [Cucumis sativus] Length = 907 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = +1 Query: 70 ASSDGFNFNIASKYSLYLFDTRKPLSPVLQWAHNLDEPTYMQVF 201 A SDGF F+IAS + L L D RKPLSPVLQW H LD+P+YM VF Sbjct: 344 AGSDGFYFSIASNHLLLLCDIRKPLSPVLQWTHGLDDPSYMNVF 387 >emb|CAN64638.1| hypothetical protein VITISV_033929 [Vitis vinifera] Length = 865 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = +1 Query: 70 ASSDGFNFNIASKYSLYLFDTRKPLSPVLQWAHNLDEPTYMQVFK 204 A S+GF+F +AS L+L+D R PL PVLQW+H +D+P Y++VFK Sbjct: 295 AGSNGFHFTVASNSLLFLYDIRNPLIPVLQWSHGIDKPCYVRVFK 339 >ref|XP_002530358.1| conserved hypothetical protein [Ricinus communis] gi|223530105|gb|EEF32019.1| conserved hypothetical protein [Ricinus communis] Length = 912 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = +1 Query: 70 ASSDGFNFNIASKYSLYLFDTRKPLSPVLQWAHNLDEPTYMQVFK 204 A SD F F +AS+ L L D RKPL PVLQWAH LD P Y+ VF+ Sbjct: 343 AVSDHFQFVLASENMLALCDVRKPLMPVLQWAHALDRPCYIDVFR 387