BLASTX nr result
ID: Papaver22_contig00019937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00019937 (489 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24177.3| unnamed protein product [Vitis vinifera] 92 6e-17 ref|XP_002263178.1| PREDICTED: ATP-dependent zinc metalloproteas... 92 6e-17 ref|XP_003530406.1| PREDICTED: ATP-dependent zinc metalloproteas... 87 1e-15 ref|XP_002513356.1| Cell division protein ftsH, putative [Ricinu... 86 3e-15 ref|XP_003628399.1| Cell division protease ftsH-like protein [Me... 79 4e-13 >emb|CBI24177.3| unnamed protein product [Vitis vinifera] Length = 1014 Score = 91.7 bits (226), Expect = 6e-17 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +2 Query: 2 VEEKMKGLSPVMFEDFVKPYQINLDEEGPLPRNDKVRYQAPVVYQAPLHRC 154 V+EKMKGLSP+MFEDFVKP+QINL+EEGPLP ND+VRYQ +Y APLHRC Sbjct: 964 VDEKMKGLSPIMFEDFVKPFQINLEEEGPLPHNDRVRYQPLDIYPAPLHRC 1014 >ref|XP_002263178.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like [Vitis vinifera] Length = 1010 Score = 91.7 bits (226), Expect = 6e-17 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +2 Query: 2 VEEKMKGLSPVMFEDFVKPYQINLDEEGPLPRNDKVRYQAPVVYQAPLHRC 154 V+EKMKGLSP+MFEDFVKP+QINL+EEGPLP ND+VRYQ +Y APLHRC Sbjct: 960 VDEKMKGLSPIMFEDFVKPFQINLEEEGPLPHNDRVRYQPLDIYPAPLHRC 1010 >ref|XP_003530406.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like [Glycine max] Length = 982 Score = 87.4 bits (215), Expect = 1e-15 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +2 Query: 2 VEEKMKGLSPVMFEDFVKPYQINLDEEGPLPRNDKVRYQAPVVYQAPLHRC 154 VEEK+K +SPVMFEDFVKP+QIN DE+GPLP ND++RYQ P +Y APLHRC Sbjct: 932 VEEKLKEMSPVMFEDFVKPFQINPDEKGPLPHNDRLRYQLPDLYPAPLHRC 982 >ref|XP_002513356.1| Cell division protein ftsH, putative [Ricinus communis] gi|223547264|gb|EEF48759.1| Cell division protein ftsH, putative [Ricinus communis] Length = 993 Score = 85.9 bits (211), Expect = 3e-15 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +2 Query: 2 VEEKMKGLSPVMFEDFVKPYQINLDEEGPLPRNDKVRYQAPVVYQAPLHR 151 VEE MKGLSP MFEDFVKP+QIN+DEEGPLP NDK+RYQ +Y APLHR Sbjct: 943 VEEIMKGLSPTMFEDFVKPFQINIDEEGPLPHNDKLRYQPLDIYPAPLHR 992 >ref|XP_003628399.1| Cell division protease ftsH-like protein [Medicago truncatula] gi|355522421|gb|AET02875.1| Cell division protease ftsH-like protein [Medicago truncatula] Length = 988 Score = 79.0 bits (193), Expect = 4e-13 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = +2 Query: 2 VEEKMKGLSPVMFEDFVKPYQINLDEEGPLPRNDKVRYQAPVVYQAPLHRC 154 VEEKMK LSPVMF+DFVKP+Q++ +E+GPLP ND + Y+ +Y APLHRC Sbjct: 938 VEEKMKQLSPVMFDDFVKPFQVDCEEDGPLPHNDDIHYRTADLYPAPLHRC 988