BLASTX nr result
ID: Papaver22_contig00019936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00019936 (539 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24177.3| unnamed protein product [Vitis vinifera] 95 8e-18 ref|XP_002263178.1| PREDICTED: ATP-dependent zinc metalloproteas... 95 8e-18 ref|XP_003530406.1| PREDICTED: ATP-dependent zinc metalloproteas... 91 1e-16 ref|XP_002513356.1| Cell division protein ftsH, putative [Ricinu... 89 4e-16 ref|XP_003628399.1| Cell division protease ftsH-like protein [Me... 82 5e-14 >emb|CBI24177.3| unnamed protein product [Vitis vinifera] Length = 1014 Score = 94.7 bits (234), Expect = 8e-18 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +3 Query: 3 VEEKMKGLSPVMFEDFVKPYQINLDEEGPLPHNDKVRYQAPVVYQAPLHRC 155 V+EKMKGLSP+MFEDFVKP+QINL+EEGPLPHND+VRYQ +Y APLHRC Sbjct: 964 VDEKMKGLSPIMFEDFVKPFQINLEEEGPLPHNDRVRYQPLDIYPAPLHRC 1014 >ref|XP_002263178.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like [Vitis vinifera] Length = 1010 Score = 94.7 bits (234), Expect = 8e-18 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +3 Query: 3 VEEKMKGLSPVMFEDFVKPYQINLDEEGPLPHNDKVRYQAPVVYQAPLHRC 155 V+EKMKGLSP+MFEDFVKP+QINL+EEGPLPHND+VRYQ +Y APLHRC Sbjct: 960 VDEKMKGLSPIMFEDFVKPFQINLEEEGPLPHNDRVRYQPLDIYPAPLHRC 1010 >ref|XP_003530406.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like [Glycine max] Length = 982 Score = 90.5 bits (223), Expect = 1e-16 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +3 Query: 3 VEEKMKGLSPVMFEDFVKPYQINLDEEGPLPHNDKVRYQAPVVYQAPLHRC 155 VEEK+K +SPVMFEDFVKP+QIN DE+GPLPHND++RYQ P +Y APLHRC Sbjct: 932 VEEKLKEMSPVMFEDFVKPFQINPDEKGPLPHNDRLRYQLPDLYPAPLHRC 982 >ref|XP_002513356.1| Cell division protein ftsH, putative [Ricinus communis] gi|223547264|gb|EEF48759.1| Cell division protein ftsH, putative [Ricinus communis] Length = 993 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +3 Query: 3 VEEKMKGLSPVMFEDFVKPYQINLDEEGPLPHNDKVRYQAPVVYQAPLHR 152 VEE MKGLSP MFEDFVKP+QIN+DEEGPLPHNDK+RYQ +Y APLHR Sbjct: 943 VEEIMKGLSPTMFEDFVKPFQINIDEEGPLPHNDKLRYQPLDIYPAPLHR 992 >ref|XP_003628399.1| Cell division protease ftsH-like protein [Medicago truncatula] gi|355522421|gb|AET02875.1| Cell division protease ftsH-like protein [Medicago truncatula] Length = 988 Score = 82.0 bits (201), Expect = 5e-14 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = +3 Query: 3 VEEKMKGLSPVMFEDFVKPYQINLDEEGPLPHNDKVRYQAPVVYQAPLHRC 155 VEEKMK LSPVMF+DFVKP+Q++ +E+GPLPHND + Y+ +Y APLHRC Sbjct: 938 VEEKMKQLSPVMFDDFVKPFQVDCEEDGPLPHNDDIHYRTADLYPAPLHRC 988