BLASTX nr result
ID: Papaver22_contig00019169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00019169 (431 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthami... 77 2e-12 sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Shor... 75 6e-12 gb|AAQ23135.1| thioredoxin H3 [Ipomoea batatas] 69 3e-10 gb|AAR83852.1| thioredoxin [Capsicum annuum] gi|125489263|gb|ABN... 69 4e-10 gb|AAL26915.1|AF323593_1 thioredoxin H [Prunus persica] 69 4e-10 >gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthamiana] Length = 119 Score = 76.6 bits (187), Expect = 2e-12 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -3 Query: 429 VSEEWNVEAMPTFVFLKDGKEVDRVVGAKKDELQNTIAKHSC*SDDTA 286 V+EEW+VEAMPTFVFLKDGKEVDRVVGAKK+ELQ TI KH+ + TA Sbjct: 72 VAEEWSVEAMPTFVFLKDGKEVDRVVGAKKEELQQTILKHAAPATVTA 119 >sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Short=Trx-H1 gi|20047|emb|CAA41415.1| thioredoxin [Nicotiana tabacum] Length = 126 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -3 Query: 429 VSEEWNVEAMPTFVFLKDGKEVDRVVGAKKDELQNTIAKHSC*SDDTA 286 VS EW+VEAMPTFVF+KDGKEVDRVVGAKK+ELQ TI KH+ + TA Sbjct: 79 VSAEWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTIVKHAAPATVTA 126 >gb|AAQ23135.1| thioredoxin H3 [Ipomoea batatas] Length = 123 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 429 VSEEWNVEAMPTFVFLKDGKEVDRVVGAKKDELQNTIAKHS 307 V+ E+ VEAMPTFVFLKDGKEVDR+VGAKKD+LQN I KH+ Sbjct: 77 VAAEYKVEAMPTFVFLKDGKEVDRMVGAKKDDLQNCITKHA 117 >gb|AAR83852.1| thioredoxin [Capsicum annuum] gi|125489263|gb|ABN42904.1| thioredoxin H-type [Capsicum annuum] Length = 124 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -3 Query: 429 VSEEWNVEAMPTFVFLKDGKEVDRVVGAKKDELQNTIAKH 310 V+EEWNV+AMPTFVF KDG+EVDRVVGA+K+ELQ I KH Sbjct: 76 VAEEWNVDAMPTFVFFKDGEEVDRVVGAQKEELQAAILKH 115 >gb|AAL26915.1|AF323593_1 thioredoxin H [Prunus persica] Length = 136 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -3 Query: 429 VSEEWNVEAMPTFVFLKDGKEVDRVVGAKKDELQNTIAKH 310 VSEEW VEAMPTF+FLK+GK VD+VVGAKKDELQ +AKH Sbjct: 72 VSEEWGVEAMPTFLFLKEGKIVDKVVGAKKDELQIKVAKH 111