BLASTX nr result
ID: Papaver22_contig00017822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00017822 (1602 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003620615.1| hypothetical protein MTR_6g087780 [Medicago ... 57 3e-06 >ref|XP_003620615.1| hypothetical protein MTR_6g087780 [Medicago truncatula] gi|355495630|gb|AES76833.1| hypothetical protein MTR_6g087780 [Medicago truncatula] Length = 54 Score = 57.0 bits (136), Expect(2) = 3e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 526 NLRLVSQEHSQLPPKSFRLSPGLRANAALSFLGCLK 633 N++ +HSQ PPKSFRLSPGLR NAA+SFLGCL+ Sbjct: 6 NIKACFSKHSQWPPKSFRLSPGLRVNAAVSFLGCLR 41 Score = 22.3 bits (46), Expect(2) = 3e-06 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 516 NDDKSKACFSR 548 NDD KACFS+ Sbjct: 3 NDDNIKACFSK 13