BLASTX nr result
ID: Papaver22_contig00017763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00017763 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q06395.1|ML149_PAPSO RecName: Full=Major latex protein 149; S... 55 8e-06 >sp|Q06395.1|ML149_PAPSO RecName: Full=Major latex protein 149; Short=MLP 149 gi|294062|gb|AAA19245.1| major latex protein [Papaver somniferum] Length = 159 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = +3 Query: 6 LAVSPNSKDVGCGGTVRFSIEYEKNNEDSPAPITYIALCQKIIEGMNAYLRSS 164 L V P KD G G V++ ++YEK NEDSP PI Y+ALC + E +N YL +S Sbjct: 108 LVVDP--KDNGHGSIVKYILDYEKINEDSPVPIHYLALCNQATEDLNTYLCAS 158