BLASTX nr result
ID: Papaver22_contig00016955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00016955 (511 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI93819.1| fatty acid 9/13-hydroperoxide lyase [Solanum penn... 148 4e-34 gb|AAK54282.1|AF081955_1 fatty acid 9-hydroperoxide lyase [Cucum... 146 2e-33 gb|ABC75838.1| cytochrome P450 CYP74C9 [Petunia integrifolia sub... 145 3e-33 ref|NP_001234502.1| cytochrome P450 CYP74C4 [Solanum lycopersicu... 145 3e-33 emb|CBI32527.3| unnamed protein product [Vitis vinifera] 145 4e-33 >gb|ABI93819.1| fatty acid 9/13-hydroperoxide lyase [Solanum pennellii] Length = 488 Score = 148 bits (374), Expect = 4e-34 Identities = 71/104 (68%), Positives = 81/104 (77%) Frame = -1 Query: 511 KDEILFGYQPLAMRDPKIFENPNEFIGTRFMGAEGEKLLKYAYWSNERQTVDPTPDNKQC 332 K E++FGYQ A +D KIFENP EFI RFMG+EGEKLLKY YWSN R+T DPT DNKQC Sbjct: 382 KGEMIFGYQTFATKDAKIFENPEEFIAERFMGSEGEKLLKYVYWSNARETDDPTVDNKQC 441 Query: 331 AGKDIVLLLARLLVVEFFLRYDTFTAEIGKNYTGSTVIFKTLIK 200 KD+V+LL RLL+VEFF+RYDTFT E K GS+V FKTL K Sbjct: 442 PAKDLVVLLCRLLLVEFFMRYDTFTVESRKYLAGSSVTFKTLDK 485 >gb|AAK54282.1|AF081955_1 fatty acid 9-hydroperoxide lyase [Cucumis melo] Length = 481 Score = 146 bits (368), Expect = 2e-33 Identities = 65/105 (61%), Positives = 84/105 (80%) Frame = -1 Query: 511 KDEILFGYQPLAMRDPKIFENPNEFIGTRFMGAEGEKLLKYAYWSNERQTVDPTPDNKQC 332 K E +FGYQP A +DPKIF++ +F+G RF+G EGEKLLKY YWSNER+TV+PTP+NKQC Sbjct: 373 KGETIFGYQPFATKDPKIFKDSEKFVGDRFVGEEGEKLLKYVYWSNERETVEPTPENKQC 432 Query: 331 AGKDIVLLLARLLVVEFFLRYDTFTAEIGKNYTGSTVIFKTLIKA 197 GK++V+L+ R++VVEFFLRYDTFT E+ G V FK+L +A Sbjct: 433 PGKNLVVLIGRIMVVEFFLRYDTFTVEVADLPLGPAVKFKSLTRA 477 >gb|ABC75838.1| cytochrome P450 CYP74C9 [Petunia integrifolia subsp. inflata] gi|85720843|gb|ABC75839.1| cytochrome P450 CYP74C9 [Petunia integrifolia subsp. inflata] Length = 480 Score = 145 bits (366), Expect = 3e-33 Identities = 69/105 (65%), Positives = 86/105 (81%) Frame = -1 Query: 511 KDEILFGYQPLAMRDPKIFENPNEFIGTRFMGAEGEKLLKYAYWSNERQTVDPTPDNKQC 332 KDEI+FGYQPLA +DPKIF+NP EFIG RFMG +GEKL++Y YWSN +++ DPT ++KQC Sbjct: 375 KDEIIFGYQPLATKDPKIFDNPEEFIGDRFMG-DGEKLIEYVYWSNGKESDDPTVNDKQC 433 Query: 331 AGKDIVLLLARLLVVEFFLRYDTFTAEIGKNYTGSTVIFKTLIKA 197 GK++V+LL RLL+VEFFLRYDTF E GK GS V FK++ KA Sbjct: 434 PGKNLVVLLGRLLLVEFFLRYDTFDIEYGKLLLGSKVSFKSVTKA 478 >ref|NP_001234502.1| cytochrome P450 CYP74C4 [Solanum lycopersicum] gi|19310992|gb|AAL86702.1|AF461042_1 cytochrome P450 CYP74C4 [Solanum lycopersicum] Length = 494 Score = 145 bits (366), Expect = 3e-33 Identities = 68/104 (65%), Positives = 79/104 (75%) Frame = -1 Query: 511 KDEILFGYQPLAMRDPKIFENPNEFIGTRFMGAEGEKLLKYAYWSNERQTVDPTPDNKQC 332 K E++FGYQ A +D KIFENP EFI RFMG+EGEKLLKY YWSN R+T PT DNKQC Sbjct: 388 KGEMIFGYQTFATKDAKIFENPEEFIAERFMGSEGEKLLKYVYWSNARETDSPTVDNKQC 447 Query: 331 AGKDIVLLLARLLVVEFFLRYDTFTAEIGKNYTGSTVIFKTLIK 200 AG+D+ +LL RLL+VEFF+RYDTFT E K G + FKTL K Sbjct: 448 AGRDLAVLLCRLLLVEFFMRYDTFTVESSKYLAGPLITFKTLEK 491 >emb|CBI32527.3| unnamed protein product [Vitis vinifera] Length = 614 Score = 145 bits (365), Expect = 4e-33 Identities = 67/105 (63%), Positives = 86/105 (81%) Frame = -1 Query: 511 KDEILFGYQPLAMRDPKIFENPNEFIGTRFMGAEGEKLLKYAYWSNERQTVDPTPDNKQC 332 K E++FGYQP A +DPK+F+NP EF+G RFMG EGE+LLKY YWSN R++ +PT +NKQC Sbjct: 508 KGEMIFGYQPFATKDPKVFDNPEEFMGNRFMG-EGERLLKYVYWSNGRESGNPTVENKQC 566 Query: 331 AGKDIVLLLARLLVVEFFLRYDTFTAEIGKNYTGSTVIFKTLIKA 197 AGKD+VLLL+R+++VEFFLRYDTF E G GS+V FK++ KA Sbjct: 567 AGKDLVLLLSRVMLVEFFLRYDTFDIESGTLLLGSSVTFKSITKA 611