BLASTX nr result
ID: Papaver22_contig00016762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00016762 (625 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284718.1| PREDICTED: uncharacterized protein LOC100250... 72 1e-10 ref|XP_002428724.1| zinc finger protein RNA binding protein, put... 56 6e-06 >ref|XP_002284718.1| PREDICTED: uncharacterized protein LOC100250232 [Vitis vinifera] Length = 223 Score = 71.6 bits (174), Expect = 1e-10 Identities = 49/158 (31%), Positives = 76/158 (48%), Gaps = 30/158 (18%) Frame = -3 Query: 590 RTTTIPTELGIQRELESERKMQNLQ---SGFKFQERPVPSQGSTPNQNT--AQVNEMAAF 426 R +P EL ++REL +K+ L G +E PVPS P+ + + + A Sbjct: 5 RGEVMPLELAMKRELAYRKKVDRLLLQLHGGVSRENPVPSSSPRPSSGSKFSGIKRKAPT 64 Query: 425 MNLGYPLPRKVKQQYD-------QKNPLYCKACKVLCSGVKALRMHLRGRRH-------- 291 + PR++ Q D Q++ L+CK C+V CSG +L+ HL G++H Sbjct: 65 SSFNCQ-PRQMLQPVDHSNTLKTQRDDLFCKVCQVPCSGANSLKQHLLGQKHKDRLQNLT 123 Query: 290 -----GSE-----LVCEVCVVPCTDENSLRRHLSGQKH 207 G E L CE+C + C ++NS + HL G+KH Sbjct: 124 PSMGIGEEGAKQRLWCELCKIWCMNKNSFKDHLKGKKH 161 >ref|XP_002428724.1| zinc finger protein RNA binding protein, putative [Pediculus humanus corporis] gi|212513409|gb|EEB15986.1| zinc finger protein RNA binding protein, putative [Pediculus humanus corporis] Length = 932 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/85 (32%), Positives = 39/85 (45%), Gaps = 20/85 (23%) Frame = -3 Query: 401 RKVKQQYDQKNPLYCKACKVLCSGVKALRMHLRGR--------------------RHGSE 282 RK+K + LYC+ CK+ C G + R HL G+ RH + Sbjct: 300 RKLKPAPKPQQLLYCEVCKISCGGPQTYREHLEGQKHKKKESAAKIIGTPAPPPARHSNS 359 Query: 281 LVCEVCVVPCTDENSLRRHLSGQKH 207 LVCE+C V CT ++ H+ G KH Sbjct: 360 LVCELCEVTCTGNDAYAAHIRGAKH 384