BLASTX nr result
ID: Papaver22_contig00016466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00016466 (796 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_565138.1| Nucleotide-sugar transporter family protein [Ar... 66 8e-09 ref|NP_564133.1| nucleotide-sugar transporter-like protein [Arab... 65 1e-08 ref|XP_003562824.1| PREDICTED: LOW QUALITY PROTEIN: UDP-galactos... 65 1e-08 dbj|BAJ33722.1| unnamed protein product [Thellungiella halophila] 65 1e-08 ref|XP_002893149.1| hypothetical protein ARALYDRAFT_889562 [Arab... 65 1e-08 >ref|NP_565138.1| Nucleotide-sugar transporter family protein [Arabidopsis thaliana] gi|75207337|sp|Q9SRE4.1|UGAL2_ARATH RecName: Full=UDP-galactose transporter 2; Short=At-UDP-GalT2 gi|6143887|gb|AAF04433.1|AC010718_2 unknown protein; 11341-9662 [Arabidopsis thaliana] gi|14532698|gb|AAK64150.1| unknown protein [Arabidopsis thaliana] gi|16604380|gb|AAL24196.1| At1g76670/F28O16_4 [Arabidopsis thaliana] gi|18491195|gb|AAL69500.1| unknown protein [Arabidopsis thaliana] gi|23308311|gb|AAN18125.1| At1g76670/F28O16_4 [Arabidopsis thaliana] gi|46934766|emb|CAG18177.1| UDP-galactose transporter [Arabidopsis thaliana] gi|332197752|gb|AEE35873.1| Nucleotide-sugar transporter family protein [Arabidopsis thaliana] Length = 347 Score = 66.2 bits (160), Expect = 8e-09 Identities = 35/48 (72%), Positives = 40/48 (83%), Gaps = 2/48 (4%) Frame = +1 Query: 646 MVFKSTGLSASKHVPLWELLRFSIVANIT--*MSLRLMLNSVGFYQVN 783 MV +TGLSASKHVPLWELL FSIVANI+ M+ LMLNSVGFYQ++ Sbjct: 62 MVSNATGLSASKHVPLWELLWFSIVANISIAAMNFSLMLNSVGFYQIS 109 >ref|NP_564133.1| nucleotide-sugar transporter-like protein [Arabidopsis thaliana] gi|8886994|gb|AAF80654.1|AC012190_10 Strong similarity to a hypothetical protein F28O16.4 gi|6143887 from Arabidopsis thaliana gb|AC010718. It contains a integral membrane protein domain PF|00892 [Arabidopsis thaliana] gi|89000949|gb|ABD59064.1| At1g21070 [Arabidopsis thaliana] gi|332191938|gb|AEE30059.1| nucleotide-sugar transporter-like protein [Arabidopsis thaliana] Length = 348 Score = 65.5 bits (158), Expect = 1e-08 Identities = 34/48 (70%), Positives = 40/48 (83%), Gaps = 2/48 (4%) Frame = +1 Query: 646 MVFKSTGLSASKHVPLWELLRFSIVANIT--*MSLRLMLNSVGFYQVN 783 MV +TGLSASKHVPLWELL FS+VANI+ M+ LMLNSVGFYQ++ Sbjct: 63 MVSNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQIS 110 >ref|XP_003562824.1| PREDICTED: LOW QUALITY PROTEIN: UDP-galactose transporter 2-like [Brachypodium distachyon] Length = 349 Score = 65.5 bits (158), Expect = 1e-08 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 2/47 (4%) Frame = +1 Query: 649 VFKSTGLSASKHVPLWELLRFSIVAN--IT*MSLRLMLNSVGFYQVN 783 + K+TG SASKHVPLWEL+ FS+VAN IT M+L LMLNSVGFYQ++ Sbjct: 61 ISKATGYSASKHVPLWELIWFSLVANTSITGMNLSLMLNSVGFYQIS 107 >dbj|BAJ33722.1| unnamed protein product [Thellungiella halophila] Length = 348 Score = 65.5 bits (158), Expect = 1e-08 Identities = 34/48 (70%), Positives = 39/48 (81%), Gaps = 2/48 (4%) Frame = +1 Query: 646 MVFKSTGLSASKHVPLWELLRFSIVAN--IT*MSLRLMLNSVGFYQVN 783 MV +TGLSASKH+PLWELL FSIVAN I M+ LMLNSVGFYQ++ Sbjct: 63 MVSNATGLSASKHIPLWELLWFSIVANVSIAAMNFSLMLNSVGFYQIS 110 >ref|XP_002893149.1| hypothetical protein ARALYDRAFT_889562 [Arabidopsis lyrata subsp. lyrata] gi|297338991|gb|EFH69408.1| hypothetical protein ARALYDRAFT_889562 [Arabidopsis lyrata subsp. lyrata] Length = 348 Score = 65.5 bits (158), Expect = 1e-08 Identities = 34/48 (70%), Positives = 40/48 (83%), Gaps = 2/48 (4%) Frame = +1 Query: 646 MVFKSTGLSASKHVPLWELLRFSIVANIT--*MSLRLMLNSVGFYQVN 783 MV +TGLSASKHVPLWELL FS+VANI+ M+ LMLNSVGFYQ++ Sbjct: 63 MVSNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQIS 110