BLASTX nr result
ID: Papaver22_contig00016430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00016430 (694 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527405.1| Protein SEY1, putative [Ricinus communis] gi... 85 1e-14 ref|XP_002884994.1| hypothetical protein ARALYDRAFT_478791 [Arab... 85 2e-14 ref|XP_002327435.1| predicted protein [Populus trichocarpa] gi|2... 83 5e-14 ref|XP_003529864.1| PREDICTED: protein ROOT HAIR DEFECTIVE 3 hom... 82 1e-13 ref|NP_974308.1| Root hair defective 3 GTP-binding protein RHD3 ... 82 1e-13 >ref|XP_002527405.1| Protein SEY1, putative [Ricinus communis] gi|223533215|gb|EEF34971.1| Protein SEY1, putative [Ricinus communis] Length = 813 Score = 85.1 bits (209), Expect = 1e-14 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 694 KALWVQLDISGEFRNGALPGLLSLSTKFLPTVMNLLKKLAEEG 566 KALWVQLD+SGEFRNGALPGL+SLSTKFLPT+MNL+KKLAEEG Sbjct: 719 KALWVQLDVSGEFRNGALPGLISLSTKFLPTIMNLIKKLAEEG 761 >ref|XP_002884994.1| hypothetical protein ARALYDRAFT_478791 [Arabidopsis lyrata subsp. lyrata] gi|297330834|gb|EFH61253.1| hypothetical protein ARALYDRAFT_478791 [Arabidopsis lyrata subsp. lyrata] Length = 803 Score = 84.7 bits (208), Expect = 2e-14 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 694 KALWVQLDISGEFRNGALPGLLSLSTKFLPTVMNLLKKLAEEG 566 KALWVQL+ISGEFRNGALPGLLSLSTKF+PTVMNLLKKLAEEG Sbjct: 715 KALWVQLNISGEFRNGALPGLLSLSTKFIPTVMNLLKKLAEEG 757 >ref|XP_002327435.1| predicted protein [Populus trichocarpa] gi|222835989|gb|EEE74410.1| predicted protein [Populus trichocarpa] Length = 716 Score = 83.2 bits (204), Expect = 5e-14 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 694 KALWVQLDISGEFRNGALPGLLSLSTKFLPTVMNLLKKLAEEG 566 KALWVQLDISGEFRNGALPGLLSLS+KF+PT+MNLLK+LAEEG Sbjct: 624 KALWVQLDISGEFRNGALPGLLSLSSKFVPTIMNLLKRLAEEG 666 >ref|XP_003529864.1| PREDICTED: protein ROOT HAIR DEFECTIVE 3 homolog 1-like [Glycine max] Length = 808 Score = 82.0 bits (201), Expect = 1e-13 Identities = 36/43 (83%), Positives = 43/43 (100%) Frame = -1 Query: 694 KALWVQLDISGEFRNGALPGLLSLSTKFLPTVMNLLKKLAEEG 566 KALWVQLD+SGEFRNGALPG++SLS+KF+PT+MNL+KKLAEEG Sbjct: 719 KALWVQLDVSGEFRNGALPGIISLSSKFIPTIMNLMKKLAEEG 761 >ref|NP_974308.1| Root hair defective 3 GTP-binding protein RHD3 [Arabidopsis thaliana] gi|332641907|gb|AEE75428.1| Root hair defective 3 GTP-binding protein RHD3 [Arabidopsis thaliana] Length = 738 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 694 KALWVQLDISGEFRNGALPGLLSLSTKFLPTVMNLLKKLAEEG 566 KALWVQL+ISGEF+NG LPGLLSLSTKF+PTVMNLLKKLAEEG Sbjct: 651 KALWVQLNISGEFQNGVLPGLLSLSTKFIPTVMNLLKKLAEEG 693