BLASTX nr result
ID: Papaver22_contig00016311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00016311 (459 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB82639.1| putative non-LTR retroelement reverse transcripta... 58 7e-07 >gb|AAB82639.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1374 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 3/77 (3%) Frame = +3 Query: 234 QNIISLHLPKQPKADQLVWPYSKTGNYTSKTGY---SKLISQTTNSPINRTPTQQPVDYK 404 +NI++L + D+ W YS++G+Y+ K+GY +++I+Q N P+ P+ ++ Sbjct: 994 ENILALRPGGKETRDRFTWEYSRSGHYSVKSGYWVMTEIINQRNNPQEVLQPSLDPI-FQ 1052 Query: 405 SIWKLRCPPKIRLFLWK 455 IWKL PPKI FLW+ Sbjct: 1053 QIWKLDVPPKIHHFLWR 1069